Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 665

Gene

ZNF665

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri113 – 13523C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri141 – 16323C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri169 – 19123C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri197 – 21923C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri225 – 24723C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri253 – 27523C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri281 – 30323C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri309 – 33123C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri337 – 35923C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri365 – 38723C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri393 – 41523C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri421 – 44323C2H2-type 12PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri449 – 47123C2H2-type 13PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri477 – 49923C2H2-type 14PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri505 – 52723C2H2-type 15PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri533 – 55523C2H2-type 16PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri561 – 58323C2H2-type 17PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri589 – 61123C2H2-type 18PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-212436. Generic Transcription Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 665
Alternative name(s):
Zinc finger protein 160-like
Gene namesi
Name:ZNF665
Synonyms:ZFP160L
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:25885. ZNF665.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Polymorphism and mutation databases

BioMutaiZNF665.
DMDMi325511370.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 613613Zinc finger protein 665PRO_0000325613Add
BLAST

Proteomic databases

PaxDbiQ9H7R5.
PRIDEiQ9H7R5.

PTM databases

iPTMnetiQ9H7R5.
PhosphoSiteiQ9H7R5.

Expressioni

Gene expression databases

BgeeiQ9H7R5.
CleanExiHS_ZNF665.
GenevisibleiQ9H7R5. HS.

Organism-specific databases

HPAiHPA023437.

Interactioni

Protein-protein interaction databases

IntActiQ9H7R5. 1 interaction.
STRINGi9606.ENSP00000379702.

Structurei

3D structure databases

ProteinModelPortaliQ9H7R5.
SMRiQ9H7R5. Positions 111-612.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Contains 18 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri113 – 13523C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri141 – 16323C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri169 – 19123C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri197 – 21923C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri225 – 24723C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri253 – 27523C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri281 – 30323C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri309 – 33123C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri337 – 35923C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri365 – 38723C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri393 – 41523C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri421 – 44323C2H2-type 12PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri449 – 47123C2H2-type 13PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri477 – 49923C2H2-type 14PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri505 – 52723C2H2-type 15PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri533 – 55523C2H2-type 16PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri561 – 58323C2H2-type 17PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri589 – 61123C2H2-type 18PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00690000102079.
HOGENOMiHOG000234617.
HOVERGENiHBG018163.
InParanoidiQ9H7R5.
KOiK09228.
OMAiEVQKNTY.
OrthoDBiEOG7KSX7Q.
PhylomeDBiQ9H7R5.
TreeFamiTF341892.

Family and domain databases

Gene3Di3.30.160.60. 18 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00096. zf-C2H2. 11 hits.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 18 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 18 hits.
PS50157. ZINC_FINGER_C2H2_2. 18 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H7R5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGEAFYTVKL ERLESCDTVG LSFQEVQKNT YDFECQWKDD EGNYKTVLML
60 70 80 90 100
QKENLPGRRA QRDRRAAGNR HIENQLGVSF QSHLPELQQF QHEGKIYEYN
110 120 130 140 150
QVEKSPNNRG KHYKCDECGK VFSQNSRLTS HKRIHTGEKP YQCNKCGKAF
160 170 180 190 200
TVRSNLTIHQ VIHTGEKPYK CNECGKVFSQ PSNLAGHQRI HTGEKPYKCN
210 220 230 240 250
ECGKAFRAHS KLTTHQVIHT GEKPYKCKEC GKCFTQNSHL ASHRRIHTGE
260 270 280 290 300
KPYKCNECGK AFSVRSSLTT HQTIHTGEKP YKCNECGKVF RHNSYLAKHR
310 320 330 340 350
RIHTGEKPYK CNECGKAFSM HSNLTKHQII HTGEKPFKCN ECVKVFTQYS
360 370 380 390 400
HLANHRRIHT GEKPYRCDEC GKAFSVRSSL TTHQAIHTGE KPYKCNDCGK
410 420 430 440 450
VFTQNSHLAS HRGIHSGEKP YKCDECGKAF SQTSQLARHW RVHTGEKPYK
460 470 480 490 500
CNECGKAFSV HSSLTIHQTI HTGQKPYKCN DCGKVFRHNS YLAIHQRIHT
510 520 530 540 550
GEKPYKCNEC GKAFSVHSNL ATHQVIHTGE KPYKCNECGK VFTQNSHLAN
560 570 580 590 600
HRRIHTGEKP YRCNECGKAF SVRSTLTTHM AVHTGDKPYK CNQCGKVFTQ
610
NSNLAKHRRI HSG
Length:613
Mass (Da):70,223
Last modified:March 8, 2011 - v2
Checksum:iDE5251006FCD0D2B
GO
Isoform 2 (identifier: Q9H7R5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MALPQGQLTFKDVAIEFSQEEWTCLDPAQKTLYRDVMLENYRNLVSLDISCKCVNTDLPPKGKNNM

Show »
Length:678
Mass (Da):77,640
Checksum:i78B5CA3D3744F7B4
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti354 – 3541N → S in BAF84092 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti19 – 191V → A.1 Publication
Corresponds to variant rs12460170 [ dbSNP | Ensembl ].
VAR_039895
Natural varianti92 – 921H → R.1 Publication
Corresponds to variant rs4801959 [ dbSNP | Ensembl ].
VAR_039896
Natural varianti582 – 5821V → I.1 Publication
Corresponds to variant rs4801958 [ dbSNP | Ensembl ].
VAR_039897

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MALPQGQLTFKDVAIEFSQE EWTCLDPAQKTLYRDVMLEN YRNLVSLDISCKCVNTDLPP KGKNNM in isoform 2. 1 PublicationVSP_040751

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024407 mRNA. Translation: BAB14911.1.
AK291403 mRNA. Translation: BAF84092.1.
AC010328 Genomic DNA. No translation available.
CCDSiCCDS46169.1. [Q9H7R5-2]
RefSeqiNP_079009.3. NM_024733.3. [Q9H7R5-2]
XP_005259323.1. XM_005259266.3. [Q9H7R5-2]
XP_006723450.1. XM_006723387.2. [Q9H7R5-2]
XP_006723451.1. XM_006723388.2. [Q9H7R5-2]
XP_011525628.1. XM_011527326.1. [Q9H7R5-2]
UniGeneiHs.745230.

Genome annotation databases

EnsembliENST00000396424; ENSP00000379702; ENSG00000197497. [Q9H7R5-2]
ENST00000600412; ENSP00000469154; ENSG00000197497. [Q9H7R5-1]
GeneIDi79788.
KEGGihsa:79788.
UCSCiuc010eqm.2. human. [Q9H7R5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024407 mRNA. Translation: BAB14911.1.
AK291403 mRNA. Translation: BAF84092.1.
AC010328 Genomic DNA. No translation available.
CCDSiCCDS46169.1. [Q9H7R5-2]
RefSeqiNP_079009.3. NM_024733.3. [Q9H7R5-2]
XP_005259323.1. XM_005259266.3. [Q9H7R5-2]
XP_006723450.1. XM_006723387.2. [Q9H7R5-2]
XP_006723451.1. XM_006723388.2. [Q9H7R5-2]
XP_011525628.1. XM_011527326.1. [Q9H7R5-2]
UniGeneiHs.745230.

3D structure databases

ProteinModelPortaliQ9H7R5.
SMRiQ9H7R5. Positions 111-612.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ9H7R5. 1 interaction.
STRINGi9606.ENSP00000379702.

PTM databases

iPTMnetiQ9H7R5.
PhosphoSiteiQ9H7R5.

Polymorphism and mutation databases

BioMutaiZNF665.
DMDMi325511370.

Proteomic databases

PaxDbiQ9H7R5.
PRIDEiQ9H7R5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000396424; ENSP00000379702; ENSG00000197497. [Q9H7R5-2]
ENST00000600412; ENSP00000469154; ENSG00000197497. [Q9H7R5-1]
GeneIDi79788.
KEGGihsa:79788.
UCSCiuc010eqm.2. human. [Q9H7R5-1]

Organism-specific databases

CTDi79788.
GeneCardsiZNF665.
HGNCiHGNC:25885. ZNF665.
HPAiHPA023437.
neXtProtiNX_Q9H7R5.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00690000102079.
HOGENOMiHOG000234617.
HOVERGENiHBG018163.
InParanoidiQ9H7R5.
KOiK09228.
OMAiEVQKNTY.
OrthoDBiEOG7KSX7Q.
PhylomeDBiQ9H7R5.
TreeFamiTF341892.

Enzyme and pathway databases

ReactomeiR-HSA-212436. Generic Transcription Pathway.

Miscellaneous databases

GenomeRNAii79788.
PROiQ9H7R5.

Gene expression databases

BgeeiQ9H7R5.
CleanExiHS_ZNF665.
GenevisibleiQ9H7R5. HS.

Family and domain databases

Gene3Di3.30.160.60. 18 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00096. zf-C2H2. 11 hits.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 18 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 18 hits.
PS50157. ZINC_FINGER_C2H2_2. 18 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS ALA-19; ARG-92 AND ILE-582.
    Tissue: Brain and Thyroid.
  2. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiZN665_HUMAN
AccessioniPrimary (citable) accession number: Q9H7R5
Secondary accession number(s): A8K5T8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 8, 2011
Last modified: June 8, 2016
This is version 127 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.