Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9H7H0

- MET17_HUMAN

UniProt

Q9H7H0 - MET17_HUMAN

Protein

Methyltransferase-like protein 17, mitochondrial

Gene

METTL17

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 85 (01 Oct 2014)
      Sequence version 1 (01 Mar 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be a component of the mitochondrial small ribosomal subunit.By similarity

    GO - Molecular functioni

    1. copper ion binding Source: InterPro
    2. methyltransferase activity Source: UniProtKB-KW
    3. protein binding Source: IntAct

    GO - Biological processi

    1. translation Source: InterPro

    Keywords - Molecular functioni

    Methyltransferase, Ribonucleoprotein, Ribosomal protein, Transferase

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Methyltransferase-like protein 17, mitochondrial (EC:2.1.1.-)
    Alternative name(s):
    False p73 target gene protein
    Methyltransferase 11 domain-containing protein 1
    Protein RSM22 homolog, mitochondrial
    Gene namesi
    Name:METTL17
    Synonyms:METT11D1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 14

    Organism-specific databases

    HGNCiHGNC:19280. METTL17.

    Subcellular locationi

    Mitochondrion By similarity

    GO - Cellular componenti

    1. mitochondrion Source: UniProtKB-SubCell
    2. ribosome Source: UniProtKB-KW

    Keywords - Cellular componenti

    Mitochondrion

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA145008140.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transit peptidei1 – 1919MitochondrionSequence AnalysisAdd
    BLAST
    Chaini20 – 456437Methyltransferase-like protein 17, mitochondrialPRO_0000312163Add
    BLAST

    Proteomic databases

    MaxQBiQ9H7H0.
    PaxDbiQ9H7H0.
    PRIDEiQ9H7H0.

    PTM databases

    PhosphoSiteiQ9H7H0.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9H7H0.
    BgeeiQ9H7H0.
    CleanExiHS_METT11D1.
    GenevestigatoriQ9H7H0.

    Organism-specific databases

    HPAiHPA002955.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    ATXN1P542535EBI-749353,EBI-930964

    Protein-protein interaction databases

    BioGridi122261. 11 interactions.
    IntActiQ9H7H0. 6 interactions.
    MINTiMINT-2875825.
    STRINGi9606.ENSP00000372445.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9H7H0.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transit peptide

    Phylogenomic databases

    eggNOGiCOG5459.
    HOVERGENiHBG061595.
    OMAiGFVSLCP.
    OrthoDBiEOG72NRPX.
    PhylomeDBiQ9H7H0.
    TreeFamiTF313708.

    Family and domain databases

    Gene3Di3.40.50.150. 1 hit.
    InterProiIPR007533. Cyt_c_oxidase_assmbl_CtaG.
    IPR015324. Ribosomal_Rsm22_bac-type.
    IPR029063. SAM-dependent_MTases-like.
    [Graphical view]
    PANTHERiPTHR21320. PTHR21320. 1 hit.
    PfamiPF09243. Rsm22. 1 hit.
    [Graphical view]
    SUPFAMiSSF53335. SSF53335. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9H7H0-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAAALKCLLT LGRWCPGLGV APQARALAAL VPGVTQVDNK SGFLQKRPHR    50
    QHPGILKLPH VRLPQALANG AQLLLLGSAG PTMENQVQTL TSYLWSRHLP 100
    VEPEELQRRA RHLEKKFLEN PDLSQTEEKL RGAVLHALRK TTYHWQELSY 150
    TEGLSLVYMA ARLDGGFAAV SRAFHEIRAR NPAFQPQTLM DFGSGTGSVT 200
    WAAHSIWGQS LREYMCVDRS AAMLVLAEKL LKGGSESGEP YIPGVFFRQF 250
    LPVSPKVQFD VVVSAFSLSE LPSKADRTEV VQTLWRKTGH FLVLVENGTK 300
    AGHSLLMDAR DLVLKGKEKS PLDPRPGFVF APCPHELPCP QLTNLACSFS 350
    QAYHPIPFSW NKKPKEEKFS MVILARGSPE EAHRWPRITQ PVLKRPRHVH 400
    CHLCCPDGHM QHAVLTARRH GRDLYRCARV SSWGDLLPVL TPSAFPPSTA 450
    QDPSES 456
    Length:456
    Mass (Da):50,734
    Last modified:March 1, 2001 - v1
    Checksum:iA23E9EF33C4BD3A1
    GO
    Isoform 2 (identifier: Q9H7H0-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         422-430: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:447
    Mass (Da):49,600
    Checksum:iC96AB962BFA9A69D
    GO
    Isoform 3 (identifier: Q9H7H0-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         423-456: DLYRCARVSSWGDLLPVLTPSAFPPSTAQDPSES → YGGCDQNQWD...VSSIYGSGSL

    Show »
    Length:478
    Mass (Da):53,051
    Checksum:i014BF85E346BF3F4
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti53 – 531P → S in AAK08200. 1 PublicationCurated
    Sequence conflicti318 – 3181E → G in AAK08200. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti289 – 2891G → A.
    Corresponds to variant rs2297717 [ dbSNP | Ensembl ].
    VAR_037422
    Natural varianti346 – 3461A → P.1 Publication
    Corresponds to variant rs2771350 [ dbSNP | Ensembl ].
    VAR_037423

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei422 – 4309Missing in isoform 2. 1 PublicationVSP_029720
    Alternative sequencei423 – 45634DLYRC…DPSES → YGGCDQNQWDVAGSCSPRQH LFPQGFVSLCPCQLLGRSFT CAYSVCVSSIYGSGSL in isoform 3. 1 PublicationVSP_029721Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF321002 mRNA. Translation: AAK08200.1.
    AF321003 Genomic DNA. Translation: AAK08201.1.
    AK024512 mRNA. Translation: BAB14919.1.
    CH471078 Genomic DNA. Translation: EAW66433.1.
    CH471078 Genomic DNA. Translation: EAW66434.1.
    BC005053 mRNA. Translation: AAH05053.1.
    CCDSiCCDS41913.1. [Q9H7H0-3]
    CCDS9562.1. [Q9H7H0-1]
    RefSeqiNP_001025162.1. NM_001029991.1. [Q9H7H0-3]
    NP_073571.1. NM_022734.2. [Q9H7H0-1]
    XP_006720298.1. XM_006720235.1. [Q9H7H0-2]
    UniGeneiHs.512693.

    Genome annotation databases

    EnsembliENST00000339374; ENSP00000343041; ENSG00000165792. [Q9H7H0-1]
    ENST00000382985; ENSP00000372445; ENSG00000165792. [Q9H7H0-3]
    ENST00000556670; ENSP00000450794; ENSG00000165792. [Q9H7H0-2]
    GeneIDi64745.
    KEGGihsa:64745.
    UCSCiuc001vym.3. human. [Q9H7H0-2]
    uc001vyn.3. human. [Q9H7H0-1]
    uc001vyo.3. human. [Q9H7H0-3]

    Polymorphism databases

    DMDMi74718673.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF321002 mRNA. Translation: AAK08200.1 .
    AF321003 Genomic DNA. Translation: AAK08201.1 .
    AK024512 mRNA. Translation: BAB14919.1 .
    CH471078 Genomic DNA. Translation: EAW66433.1 .
    CH471078 Genomic DNA. Translation: EAW66434.1 .
    BC005053 mRNA. Translation: AAH05053.1 .
    CCDSi CCDS41913.1. [Q9H7H0-3 ]
    CCDS9562.1. [Q9H7H0-1 ]
    RefSeqi NP_001025162.1. NM_001029991.1. [Q9H7H0-3 ]
    NP_073571.1. NM_022734.2. [Q9H7H0-1 ]
    XP_006720298.1. XM_006720235.1. [Q9H7H0-2 ]
    UniGenei Hs.512693.

    3D structure databases

    ProteinModelPortali Q9H7H0.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122261. 11 interactions.
    IntActi Q9H7H0. 6 interactions.
    MINTi MINT-2875825.
    STRINGi 9606.ENSP00000372445.

    PTM databases

    PhosphoSitei Q9H7H0.

    Polymorphism databases

    DMDMi 74718673.

    Proteomic databases

    MaxQBi Q9H7H0.
    PaxDbi Q9H7H0.
    PRIDEi Q9H7H0.

    Protocols and materials databases

    DNASUi 64745.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000339374 ; ENSP00000343041 ; ENSG00000165792 . [Q9H7H0-1 ]
    ENST00000382985 ; ENSP00000372445 ; ENSG00000165792 . [Q9H7H0-3 ]
    ENST00000556670 ; ENSP00000450794 ; ENSG00000165792 . [Q9H7H0-2 ]
    GeneIDi 64745.
    KEGGi hsa:64745.
    UCSCi uc001vym.3. human. [Q9H7H0-2 ]
    uc001vyn.3. human. [Q9H7H0-1 ]
    uc001vyo.3. human. [Q9H7H0-3 ]

    Organism-specific databases

    CTDi 64745.
    GeneCardsi GC14P021458.
    H-InvDB HIX0011497.
    HGNCi HGNC:19280. METTL17.
    HPAi HPA002955.
    neXtProti NX_Q9H7H0.
    PharmGKBi PA145008140.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5459.
    HOVERGENi HBG061595.
    OMAi GFVSLCP.
    OrthoDBi EOG72NRPX.
    PhylomeDBi Q9H7H0.
    TreeFami TF313708.

    Miscellaneous databases

    ChiTaRSi METTL17. human.
    GenomeRNAii 64745.
    NextBioi 66691.
    PROi Q9H7H0.

    Gene expression databases

    ArrayExpressi Q9H7H0.
    Bgeei Q9H7H0.
    CleanExi HS_METT11D1.
    Genevestigatori Q9H7H0.

    Family and domain databases

    Gene3Di 3.40.50.150. 1 hit.
    InterProi IPR007533. Cyt_c_oxidase_assmbl_CtaG.
    IPR015324. Ribosomal_Rsm22_bac-type.
    IPR029063. SAM-dependent_MTases-like.
    [Graphical view ]
    PANTHERi PTHR21320. PTHR21320. 1 hit.
    Pfami PF09243. Rsm22. 1 hit.
    [Graphical view ]
    SUPFAMi SSF53335. SSF53335. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Human genomic sequence of a false p73 target gene."
      Zheng X., Chen X.
      Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 3).
      Tissue: Mammary cancer.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-346.
      Tissue: Adipose tissue.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Lung.
    5. "Identification of 12 new yeast mitochondrial ribosomal proteins including 6 that have no prokaryotic homologues."
      Saveanu C., Fromont-Racine M., Harington A., Ricard F., Namane A., Jacquier A.
      J. Biol. Chem. 276:15861-15867(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION.

    Entry informationi

    Entry nameiMET17_HUMAN
    AccessioniPrimary (citable) accession number: Q9H7H0
    Secondary accession number(s): Q9BSH1, Q9BZH2, Q9BZH3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 4, 2007
    Last sequence update: March 1, 2001
    Last modified: October 1, 2014
    This is version 85 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 14
      Human chromosome 14: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3