Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Methyltransferase-like protein 17, mitochondrial

Gene

METTL17

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May be a component of the mitochondrial small ribosomal subunit.By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Methyltransferase, Ribonucleoprotein, Ribosomal protein, Transferase

Names & Taxonomyi

Protein namesi
Recommended name:
Methyltransferase-like protein 17, mitochondrial (EC:2.1.1.-)
Alternative name(s):
False p73 target gene protein
Methyltransferase 11 domain-containing protein 1
Protein RSM22 homolog, mitochondrial
Gene namesi
Name:METTL17
Synonyms:METT11D1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 14

Organism-specific databases

HGNCiHGNC:19280. METTL17.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA145008140.

Polymorphism and mutation databases

BioMutaiMETTL17.
DMDMi74718673.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transit peptidei1 – 1919MitochondrionSequence AnalysisAdd
BLAST
Chaini20 – 456437Methyltransferase-like protein 17, mitochondrialPRO_0000312163Add
BLAST

Proteomic databases

MaxQBiQ9H7H0.
PaxDbiQ9H7H0.
PRIDEiQ9H7H0.

PTM databases

PhosphoSiteiQ9H7H0.

Expressioni

Gene expression databases

BgeeiQ9H7H0.
CleanExiHS_METT11D1.
ExpressionAtlasiQ9H7H0. baseline and differential.
GenevisibleiQ9H7H0. HS.

Organism-specific databases

HPAiHPA002955.
HPA059802.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ATXN1P542535EBI-749353,EBI-930964
CALCOCO2Q131373EBI-749353,EBI-739580
CEP70Q8NHQ13EBI-749353,EBI-739624
KRT40Q6A1623EBI-749353,EBI-10171697
MID2Q9UJV3-23EBI-749353,EBI-10172526
PNMA1Q8ND903EBI-749353,EBI-302345
SF3B4Q154273EBI-749353,EBI-348469
SPERTQ8NA613EBI-749353,EBI-741724
TFIP11Q9UBB94EBI-749353,EBI-1105213
TRAF1Q130773EBI-749353,EBI-359224
TRIP6Q156544EBI-749353,EBI-742327

Protein-protein interaction databases

BioGridi122261. 21 interactions.
IntActiQ9H7H0. 14 interactions.
MINTiMINT-2875825.
STRINGi9606.ENSP00000372445.

Structurei

3D structure databases

ProteinModelPortaliQ9H7H0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiCOG5459.
GeneTreeiENSGT00390000006103.
HOVERGENiHBG061595.
InParanoidiQ9H7H0.
OMAiGFVSLCP.
OrthoDBiEOG72NRPX.
PhylomeDBiQ9H7H0.
TreeFamiTF313708.

Family and domain databases

Gene3Di3.40.50.150. 1 hit.
InterProiIPR007533. Cyt_c_oxidase_assmbl_CtaG.
IPR015324. Ribosomal_Rsm22_bac-type.
IPR029063. SAM-dependent_MTases.
[Graphical view]
PANTHERiPTHR21320. PTHR21320. 1 hit.
PfamiPF09243. Rsm22. 1 hit.
[Graphical view]
SUPFAMiSSF53335. SSF53335. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H7H0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAALKCLLT LGRWCPGLGV APQARALAAL VPGVTQVDNK SGFLQKRPHR
60 70 80 90 100
QHPGILKLPH VRLPQALANG AQLLLLGSAG PTMENQVQTL TSYLWSRHLP
110 120 130 140 150
VEPEELQRRA RHLEKKFLEN PDLSQTEEKL RGAVLHALRK TTYHWQELSY
160 170 180 190 200
TEGLSLVYMA ARLDGGFAAV SRAFHEIRAR NPAFQPQTLM DFGSGTGSVT
210 220 230 240 250
WAAHSIWGQS LREYMCVDRS AAMLVLAEKL LKGGSESGEP YIPGVFFRQF
260 270 280 290 300
LPVSPKVQFD VVVSAFSLSE LPSKADRTEV VQTLWRKTGH FLVLVENGTK
310 320 330 340 350
AGHSLLMDAR DLVLKGKEKS PLDPRPGFVF APCPHELPCP QLTNLACSFS
360 370 380 390 400
QAYHPIPFSW NKKPKEEKFS MVILARGSPE EAHRWPRITQ PVLKRPRHVH
410 420 430 440 450
CHLCCPDGHM QHAVLTARRH GRDLYRCARV SSWGDLLPVL TPSAFPPSTA

QDPSES
Length:456
Mass (Da):50,734
Last modified:March 1, 2001 - v1
Checksum:iA23E9EF33C4BD3A1
GO
Isoform 2 (identifier: Q9H7H0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     422-430: Missing.

Note: No experimental confirmation available.
Show »
Length:447
Mass (Da):49,600
Checksum:iC96AB962BFA9A69D
GO
Isoform 3 (identifier: Q9H7H0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     423-456: DLYRCARVSSWGDLLPVLTPSAFPPSTAQDPSES → YGGCDQNQWD...VSSIYGSGSL

Show »
Length:478
Mass (Da):53,051
Checksum:i014BF85E346BF3F4
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti53 – 531P → S in AAK08200 (Ref. 1) Curated
Sequence conflicti318 – 3181E → G in AAK08200 (Ref. 1) Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti173 – 1731A → S.1 Publication
VAR_072388
Natural varianti289 – 2891G → A.
Corresponds to variant rs2297717 [ dbSNP | Ensembl ].
VAR_037422
Natural varianti346 – 3461A → P.1 Publication
Corresponds to variant rs2771350 [ dbSNP | Ensembl ].
VAR_037423

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei422 – 4309Missing in isoform 2. 1 PublicationVSP_029720
Alternative sequencei423 – 45634DLYRC…DPSES → YGGCDQNQWDVAGSCSPRQH LFPQGFVSLCPCQLLGRSFT CAYSVCVSSIYGSGSL in isoform 3. 1 PublicationVSP_029721Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF321002 mRNA. Translation: AAK08200.1.
AF321003 Genomic DNA. Translation: AAK08201.1.
AK024512 mRNA. Translation: BAB14919.1.
CH471078 Genomic DNA. Translation: EAW66433.1.
CH471078 Genomic DNA. Translation: EAW66434.1.
BC005053 mRNA. Translation: AAH05053.1.
CCDSiCCDS41913.1. [Q9H7H0-3]
CCDS9562.1. [Q9H7H0-1]
RefSeqiNP_001025162.1. NM_001029991.1. [Q9H7H0-3]
NP_073571.1. NM_022734.2. [Q9H7H0-1]
UniGeneiHs.512693.

Genome annotation databases

EnsembliENST00000339374; ENSP00000343041; ENSG00000165792.
ENST00000382985; ENSP00000372445; ENSG00000165792. [Q9H7H0-3]
ENST00000556670; ENSP00000450794; ENSG00000165792. [Q9H7H0-2]
GeneIDi64745.
KEGGihsa:64745.
UCSCiuc001vym.3. human. [Q9H7H0-2]
uc001vyn.3. human. [Q9H7H0-1]
uc001vyo.3. human. [Q9H7H0-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF321002 mRNA. Translation: AAK08200.1.
AF321003 Genomic DNA. Translation: AAK08201.1.
AK024512 mRNA. Translation: BAB14919.1.
CH471078 Genomic DNA. Translation: EAW66433.1.
CH471078 Genomic DNA. Translation: EAW66434.1.
BC005053 mRNA. Translation: AAH05053.1.
CCDSiCCDS41913.1. [Q9H7H0-3]
CCDS9562.1. [Q9H7H0-1]
RefSeqiNP_001025162.1. NM_001029991.1. [Q9H7H0-3]
NP_073571.1. NM_022734.2. [Q9H7H0-1]
UniGeneiHs.512693.

3D structure databases

ProteinModelPortaliQ9H7H0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122261. 21 interactions.
IntActiQ9H7H0. 14 interactions.
MINTiMINT-2875825.
STRINGi9606.ENSP00000372445.

PTM databases

PhosphoSiteiQ9H7H0.

Polymorphism and mutation databases

BioMutaiMETTL17.
DMDMi74718673.

Proteomic databases

MaxQBiQ9H7H0.
PaxDbiQ9H7H0.
PRIDEiQ9H7H0.

Protocols and materials databases

DNASUi64745.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000339374; ENSP00000343041; ENSG00000165792.
ENST00000382985; ENSP00000372445; ENSG00000165792. [Q9H7H0-3]
ENST00000556670; ENSP00000450794; ENSG00000165792. [Q9H7H0-2]
GeneIDi64745.
KEGGihsa:64745.
UCSCiuc001vym.3. human. [Q9H7H0-2]
uc001vyn.3. human. [Q9H7H0-1]
uc001vyo.3. human. [Q9H7H0-3]

Organism-specific databases

CTDi64745.
GeneCardsiGC14P021458.
H-InvDBHIX0011497.
HGNCiHGNC:19280. METTL17.
HPAiHPA002955.
HPA059802.
MIMi616091. gene.
neXtProtiNX_Q9H7H0.
PharmGKBiPA145008140.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG5459.
GeneTreeiENSGT00390000006103.
HOVERGENiHBG061595.
InParanoidiQ9H7H0.
OMAiGFVSLCP.
OrthoDBiEOG72NRPX.
PhylomeDBiQ9H7H0.
TreeFamiTF313708.

Miscellaneous databases

ChiTaRSiMETTL17. human.
GenomeRNAii64745.
NextBioi66691.
PROiQ9H7H0.
SOURCEiSearch...

Gene expression databases

BgeeiQ9H7H0.
CleanExiHS_METT11D1.
ExpressionAtlasiQ9H7H0. baseline and differential.
GenevisibleiQ9H7H0. HS.

Family and domain databases

Gene3Di3.40.50.150. 1 hit.
InterProiIPR007533. Cyt_c_oxidase_assmbl_CtaG.
IPR015324. Ribosomal_Rsm22_bac-type.
IPR029063. SAM-dependent_MTases.
[Graphical view]
PANTHERiPTHR21320. PTHR21320. 1 hit.
PfamiPF09243. Rsm22. 1 hit.
[Graphical view]
SUPFAMiSSF53335. SSF53335. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Human genomic sequence of a false p73 target gene."
    Zheng X., Chen X.
    Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 3).
    Tissue: Mammary cancer.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-346.
    Tissue: Adipose tissue.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Lung.
  5. "Identification of 12 new yeast mitochondrial ribosomal proteins including 6 that have no prokaryotic homologues."
    Saveanu C., Fromont-Racine M., Harington A., Ricard F., Namane A., Jacquier A.
    J. Biol. Chem. 276:15861-15867(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.
  6. "Sequence variants in four candidate genes (NIPSNAP1, GBAS, CHCHD1 and METT11D1) in patients with combined oxidative phosphorylation system deficiencies."
    Smits P., Rodenburg R.J., Smeitink J.A., van den Heuvel L.P.
    J. Inherit. Metab. Dis. 33 Suppl. 3:S13-19(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT SER-173.

Entry informationi

Entry nameiMET17_HUMAN
AccessioniPrimary (citable) accession number: Q9H7H0
Secondary accession number(s): Q9BSH1, Q9BZH2, Q9BZH3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: March 1, 2001
Last modified: July 22, 2015
This is version 93 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.