Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9H7H0

- MET17_HUMAN

UniProt

Q9H7H0 - MET17_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Methyltransferase-like protein 17, mitochondrial

Gene

METTL17

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli

Functioni

May be a component of the mitochondrial small ribosomal subunit.By similarity

GO - Molecular functioni

  1. copper ion binding Source: InterPro
  2. methyltransferase activity Source: UniProtKB-KW

GO - Biological processi

  1. translation Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Methyltransferase, Ribonucleoprotein, Ribosomal protein, Transferase

Names & Taxonomyi

Protein namesi
Recommended name:
Methyltransferase-like protein 17, mitochondrial (EC:2.1.1.-)
Alternative name(s):
False p73 target gene protein
Methyltransferase 11 domain-containing protein 1
Protein RSM22 homolog, mitochondrial
Gene namesi
Name:METTL17
Synonyms:METT11D1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 14

Organism-specific databases

HGNCiHGNC:19280. METTL17.

Subcellular locationi

Mitochondrion By similarity

GO - Cellular componenti

  1. mitochondrion Source: UniProtKB-KW
  2. ribosome Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA145008140.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transit peptidei1 – 1919MitochondrionSequence AnalysisAdd
BLAST
Chaini20 – 456437Methyltransferase-like protein 17, mitochondrialPRO_0000312163Add
BLAST

Proteomic databases

MaxQBiQ9H7H0.
PaxDbiQ9H7H0.
PRIDEiQ9H7H0.

PTM databases

PhosphoSiteiQ9H7H0.

Expressioni

Gene expression databases

BgeeiQ9H7H0.
CleanExiHS_METT11D1.
ExpressionAtlasiQ9H7H0. baseline and differential.
GenevestigatoriQ9H7H0.

Organism-specific databases

HPAiHPA002955.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ATXN1P542535EBI-749353,EBI-930964

Protein-protein interaction databases

BioGridi122261. 12 interactions.
IntActiQ9H7H0. 6 interactions.
MINTiMINT-2875825.
STRINGi9606.ENSP00000372445.

Structurei

3D structure databases

ProteinModelPortaliQ9H7H0.
SMRiQ9H7H0. Positions 184-297.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiCOG5459.
GeneTreeiENSGT00390000006103.
HOVERGENiHBG061595.
InParanoidiQ9H7H0.
OMAiGFVSLCP.
OrthoDBiEOG72NRPX.
PhylomeDBiQ9H7H0.
TreeFamiTF313708.

Family and domain databases

Gene3Di3.40.50.150. 1 hit.
InterProiIPR007533. Cyt_c_oxidase_assmbl_CtaG.
IPR015324. Ribosomal_Rsm22_bac-type.
IPR029063. SAM-dependent_MTases-like.
[Graphical view]
PANTHERiPTHR21320. PTHR21320. 1 hit.
PfamiPF09243. Rsm22. 1 hit.
[Graphical view]
SUPFAMiSSF53335. SSF53335. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9H7H0) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAALKCLLT LGRWCPGLGV APQARALAAL VPGVTQVDNK SGFLQKRPHR
60 70 80 90 100
QHPGILKLPH VRLPQALANG AQLLLLGSAG PTMENQVQTL TSYLWSRHLP
110 120 130 140 150
VEPEELQRRA RHLEKKFLEN PDLSQTEEKL RGAVLHALRK TTYHWQELSY
160 170 180 190 200
TEGLSLVYMA ARLDGGFAAV SRAFHEIRAR NPAFQPQTLM DFGSGTGSVT
210 220 230 240 250
WAAHSIWGQS LREYMCVDRS AAMLVLAEKL LKGGSESGEP YIPGVFFRQF
260 270 280 290 300
LPVSPKVQFD VVVSAFSLSE LPSKADRTEV VQTLWRKTGH FLVLVENGTK
310 320 330 340 350
AGHSLLMDAR DLVLKGKEKS PLDPRPGFVF APCPHELPCP QLTNLACSFS
360 370 380 390 400
QAYHPIPFSW NKKPKEEKFS MVILARGSPE EAHRWPRITQ PVLKRPRHVH
410 420 430 440 450
CHLCCPDGHM QHAVLTARRH GRDLYRCARV SSWGDLLPVL TPSAFPPSTA

QDPSES
Length:456
Mass (Da):50,734
Last modified:March 1, 2001 - v1
Checksum:iA23E9EF33C4BD3A1
GO
Isoform 2 (identifier: Q9H7H0-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     422-430: Missing.

Note: No experimental confirmation available.

Show »
Length:447
Mass (Da):49,600
Checksum:iC96AB962BFA9A69D
GO
Isoform 3 (identifier: Q9H7H0-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     423-456: DLYRCARVSSWGDLLPVLTPSAFPPSTAQDPSES → YGGCDQNQWD...VSSIYGSGSL

Show »
Length:478
Mass (Da):53,051
Checksum:i014BF85E346BF3F4
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti53 – 531P → S in AAK08200. 1 PublicationCurated
Sequence conflicti318 – 3181E → G in AAK08200. 1 PublicationCurated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti289 – 2891G → A.
Corresponds to variant rs2297717 [ dbSNP | Ensembl ].
VAR_037422
Natural varianti346 – 3461A → P.1 Publication
Corresponds to variant rs2771350 [ dbSNP | Ensembl ].
VAR_037423

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei422 – 4309Missing in isoform 2. 1 PublicationVSP_029720
Alternative sequencei423 – 45634DLYRC…DPSES → YGGCDQNQWDVAGSCSPRQH LFPQGFVSLCPCQLLGRSFT CAYSVCVSSIYGSGSL in isoform 3. 1 PublicationVSP_029721Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF321002 mRNA. Translation: AAK08200.1.
AF321003 Genomic DNA. Translation: AAK08201.1.
AK024512 mRNA. Translation: BAB14919.1.
CH471078 Genomic DNA. Translation: EAW66433.1.
CH471078 Genomic DNA. Translation: EAW66434.1.
BC005053 mRNA. Translation: AAH05053.1.
CCDSiCCDS41913.1. [Q9H7H0-3]
CCDS9562.1. [Q9H7H0-1]
RefSeqiNP_001025162.1. NM_001029991.1. [Q9H7H0-3]
NP_073571.1. NM_022734.2. [Q9H7H0-1]
XP_006720298.1. XM_006720235.1. [Q9H7H0-2]
UniGeneiHs.512693.

Genome annotation databases

EnsembliENST00000339374; ENSP00000343041; ENSG00000165792. [Q9H7H0-1]
ENST00000382985; ENSP00000372445; ENSG00000165792. [Q9H7H0-3]
ENST00000556670; ENSP00000450794; ENSG00000165792. [Q9H7H0-2]
GeneIDi64745.
KEGGihsa:64745.
UCSCiuc001vym.3. human. [Q9H7H0-2]
uc001vyn.3. human. [Q9H7H0-1]
uc001vyo.3. human. [Q9H7H0-3]

Polymorphism databases

DMDMi74718673.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF321002 mRNA. Translation: AAK08200.1 .
AF321003 Genomic DNA. Translation: AAK08201.1 .
AK024512 mRNA. Translation: BAB14919.1 .
CH471078 Genomic DNA. Translation: EAW66433.1 .
CH471078 Genomic DNA. Translation: EAW66434.1 .
BC005053 mRNA. Translation: AAH05053.1 .
CCDSi CCDS41913.1. [Q9H7H0-3 ]
CCDS9562.1. [Q9H7H0-1 ]
RefSeqi NP_001025162.1. NM_001029991.1. [Q9H7H0-3 ]
NP_073571.1. NM_022734.2. [Q9H7H0-1 ]
XP_006720298.1. XM_006720235.1. [Q9H7H0-2 ]
UniGenei Hs.512693.

3D structure databases

ProteinModelPortali Q9H7H0.
SMRi Q9H7H0. Positions 184-297.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122261. 12 interactions.
IntActi Q9H7H0. 6 interactions.
MINTi MINT-2875825.
STRINGi 9606.ENSP00000372445.

PTM databases

PhosphoSitei Q9H7H0.

Polymorphism databases

DMDMi 74718673.

Proteomic databases

MaxQBi Q9H7H0.
PaxDbi Q9H7H0.
PRIDEi Q9H7H0.

Protocols and materials databases

DNASUi 64745.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000339374 ; ENSP00000343041 ; ENSG00000165792 . [Q9H7H0-1 ]
ENST00000382985 ; ENSP00000372445 ; ENSG00000165792 . [Q9H7H0-3 ]
ENST00000556670 ; ENSP00000450794 ; ENSG00000165792 . [Q9H7H0-2 ]
GeneIDi 64745.
KEGGi hsa:64745.
UCSCi uc001vym.3. human. [Q9H7H0-2 ]
uc001vyn.3. human. [Q9H7H0-1 ]
uc001vyo.3. human. [Q9H7H0-3 ]

Organism-specific databases

CTDi 64745.
GeneCardsi GC14P021458.
H-InvDB HIX0011497.
HGNCi HGNC:19280. METTL17.
HPAi HPA002955.
neXtProti NX_Q9H7H0.
PharmGKBi PA145008140.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5459.
GeneTreei ENSGT00390000006103.
HOVERGENi HBG061595.
InParanoidi Q9H7H0.
OMAi GFVSLCP.
OrthoDBi EOG72NRPX.
PhylomeDBi Q9H7H0.
TreeFami TF313708.

Miscellaneous databases

ChiTaRSi METTL17. human.
GenomeRNAii 64745.
NextBioi 66691.
PROi Q9H7H0.

Gene expression databases

Bgeei Q9H7H0.
CleanExi HS_METT11D1.
ExpressionAtlasi Q9H7H0. baseline and differential.
Genevestigatori Q9H7H0.

Family and domain databases

Gene3Di 3.40.50.150. 1 hit.
InterProi IPR007533. Cyt_c_oxidase_assmbl_CtaG.
IPR015324. Ribosomal_Rsm22_bac-type.
IPR029063. SAM-dependent_MTases-like.
[Graphical view ]
PANTHERi PTHR21320. PTHR21320. 1 hit.
Pfami PF09243. Rsm22. 1 hit.
[Graphical view ]
SUPFAMi SSF53335. SSF53335. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Human genomic sequence of a false p73 target gene."
    Zheng X., Chen X.
    Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 3).
    Tissue: Mammary cancer.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-346.
    Tissue: Adipose tissue.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Lung.
  5. "Identification of 12 new yeast mitochondrial ribosomal proteins including 6 that have no prokaryotic homologues."
    Saveanu C., Fromont-Racine M., Harington A., Ricard F., Namane A., Jacquier A.
    J. Biol. Chem. 276:15861-15867(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.

Entry informationi

Entry nameiMET17_HUMAN
AccessioniPrimary (citable) accession number: Q9H7H0
Secondary accession number(s): Q9BSH1, Q9BZH2, Q9BZH3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: March 1, 2001
Last modified: October 29, 2014
This is version 86 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3