Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9H7H0 (MET17_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 83. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Methyltransferase-like protein 17, mitochondrial

EC=2.1.1.-
Alternative name(s):
False p73 target gene protein
Methyltransferase 11 domain-containing protein 1
Protein RSM22 homolog, mitochondrial
Gene names
Name:METTL17
Synonyms:METT11D1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length456 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May be a component of the mitochondrial small ribosomal subunit By similarity.

Subcellular location

Mitochondrion By similarity.

Sequence similarities

Belongs to the methyltransferase superfamily. Rsm22 family.

Ontologies

Keywords
   Cellular componentMitochondrion
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainTransit peptide
   Molecular functionMethyltransferase
Ribonucleoprotein
Ribosomal protein
Transferase
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processtranslation

Inferred from electronic annotation. Source: InterPro

   Cellular_componentmitochondrion

Inferred from electronic annotation. Source: UniProtKB-SubCell

ribosome

Inferred from electronic annotation. Source: UniProtKB-KW

   Molecular_functioncopper ion binding

Inferred from electronic annotation. Source: InterPro

methyltransferase activity

Inferred from electronic annotation. Source: UniProtKB-KW

protein binding

Inferred from physical interaction PubMed 16713569. Source: IntAct

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

ATXN1P542535EBI-749353,EBI-930964

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9H7H0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9H7H0-2)

The sequence of this isoform differs from the canonical sequence as follows:
     422-430: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q9H7H0-3)

The sequence of this isoform differs from the canonical sequence as follows:
     423-456: DLYRCARVSSWGDLLPVLTPSAFPPSTAQDPSES → YGGCDQNQWD...VSSIYGSGSL

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Transit peptide1 – 1919Mitochondrion Potential
Chain20 – 456437Methyltransferase-like protein 17, mitochondrial
PRO_0000312163

Natural variations

Alternative sequence422 – 4309Missing in isoform 2.
VSP_029720
Alternative sequence423 – 45634DLYRC…DPSES → YGGCDQNQWDVAGSCSPRQH LFPQGFVSLCPCQLLGRSFT CAYSVCVSSIYGSGSL in isoform 3.
VSP_029721
Natural variant2891G → A.
Corresponds to variant rs2297717 [ dbSNP | Ensembl ].
VAR_037422
Natural variant3461A → P. Ref.2
Corresponds to variant rs2771350 [ dbSNP | Ensembl ].
VAR_037423

Experimental info

Sequence conflict531P → S in AAK08200. Ref.1
Sequence conflict3181E → G in AAK08200. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 1, 2001. Version 1.
Checksum: A23E9EF33C4BD3A1

FASTA45650,734
        10         20         30         40         50         60 
MAAALKCLLT LGRWCPGLGV APQARALAAL VPGVTQVDNK SGFLQKRPHR QHPGILKLPH 

        70         80         90        100        110        120 
VRLPQALANG AQLLLLGSAG PTMENQVQTL TSYLWSRHLP VEPEELQRRA RHLEKKFLEN 

       130        140        150        160        170        180 
PDLSQTEEKL RGAVLHALRK TTYHWQELSY TEGLSLVYMA ARLDGGFAAV SRAFHEIRAR 

       190        200        210        220        230        240 
NPAFQPQTLM DFGSGTGSVT WAAHSIWGQS LREYMCVDRS AAMLVLAEKL LKGGSESGEP 

       250        260        270        280        290        300 
YIPGVFFRQF LPVSPKVQFD VVVSAFSLSE LPSKADRTEV VQTLWRKTGH FLVLVENGTK 

       310        320        330        340        350        360 
AGHSLLMDAR DLVLKGKEKS PLDPRPGFVF APCPHELPCP QLTNLACSFS QAYHPIPFSW 

       370        380        390        400        410        420 
NKKPKEEKFS MVILARGSPE EAHRWPRITQ PVLKRPRHVH CHLCCPDGHM QHAVLTARRH 

       430        440        450 
GRDLYRCARV SSWGDLLPVL TPSAFPPSTA QDPSES 

« Hide

Isoform 2 [UniParc].

Checksum: C96AB962BFA9A69D
Show »

FASTA44749,600
Isoform 3 [UniParc].

Checksum: 014BF85E346BF3F4
Show »

FASTA47853,051

References

« Hide 'large scale' references
[1]"Human genomic sequence of a false p73 target gene."
Zheng X., Chen X.
Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 3).
Tissue: Mammary cancer.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-346.
Tissue: Adipose tissue.
[3]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Lung.
[5]"Identification of 12 new yeast mitochondrial ribosomal proteins including 6 that have no prokaryotic homologues."
Saveanu C., Fromont-Racine M., Harington A., Ricard F., Namane A., Jacquier A.
J. Biol. Chem. 276:15861-15867(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF321002 mRNA. Translation: AAK08200.1.
AF321003 Genomic DNA. Translation: AAK08201.1.
AK024512 mRNA. Translation: BAB14919.1.
CH471078 Genomic DNA. Translation: EAW66433.1.
CH471078 Genomic DNA. Translation: EAW66434.1.
BC005053 mRNA. Translation: AAH05053.1.
CCDSCCDS41913.1. [Q9H7H0-3]
CCDS9562.1. [Q9H7H0-1]
RefSeqNP_001025162.1. NM_001029991.1. [Q9H7H0-3]
NP_073571.1. NM_022734.2. [Q9H7H0-1]
XP_006720298.1. XM_006720235.1. [Q9H7H0-2]
UniGeneHs.512693.

3D structure databases

ProteinModelPortalQ9H7H0.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid122261. 6 interactions.
IntActQ9H7H0. 6 interactions.
MINTMINT-2875825.
STRING9606.ENSP00000372445.

PTM databases

PhosphoSiteQ9H7H0.

Polymorphism databases

DMDM74718673.

Proteomic databases

MaxQBQ9H7H0.
PaxDbQ9H7H0.
PRIDEQ9H7H0.

Protocols and materials databases

DNASU64745.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000339374; ENSP00000343041; ENSG00000165792. [Q9H7H0-1]
ENST00000382985; ENSP00000372445; ENSG00000165792. [Q9H7H0-3]
ENST00000556670; ENSP00000450794; ENSG00000165792. [Q9H7H0-2]
GeneID64745.
KEGGhsa:64745.
UCSCuc001vym.3. human. [Q9H7H0-2]
uc001vyn.3. human. [Q9H7H0-1]
uc001vyo.3. human. [Q9H7H0-3]

Organism-specific databases

CTD64745.
GeneCardsGC14P021458.
H-InvDBHIX0011497.
HGNCHGNC:19280. METTL17.
HPAHPA002955.
neXtProtNX_Q9H7H0.
PharmGKBPA145008140.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5459.
HOVERGENHBG061595.
OMAGFVSLCP.
OrthoDBEOG72NRPX.
PhylomeDBQ9H7H0.
TreeFamTF313708.

Gene expression databases

ArrayExpressQ9H7H0.
BgeeQ9H7H0.
CleanExHS_METT11D1.
GenevestigatorQ9H7H0.

Family and domain databases

Gene3D3.40.50.150. 1 hit.
InterProIPR007533. Cyt_c_oxidase_assmbl_CtaG.
IPR015324. Ribosomal_Rsm22_bac-type.
IPR029063. SAM-dependent_MTases-like.
[Graphical view]
PANTHERPTHR21320. PTHR21320. 1 hit.
PfamPF09243. Rsm22. 1 hit.
[Graphical view]
SUPFAMSSF53335. SSF53335. 1 hit.
ProtoNetSearch...

Other

ChiTaRSMETTL17. human.
GenomeRNAi64745.
NextBio66691.
PROQ9H7H0.

Entry information

Entry nameMET17_HUMAN
AccessionPrimary (citable) accession number: Q9H7H0
Secondary accession number(s): Q9BSH1, Q9BZH2, Q9BZH3
Entry history
Integrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: March 1, 2001
Last modified: July 9, 2014
This is version 83 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 14

Human chromosome 14: entries, gene names and cross-references to MIM