Q9H7H0 (MET17_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 74.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Methyltransferase-like protein 17, mitochondrial EC=2.1.1.- Alternative name(s): False p73 target gene protein Methyltransferase 11 domain-containing protein 1 Protein RSM22 homolog, mitochondrial | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 456 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May be a component of the mitochondrial small ribosomal subunit By similarity. |
| Subcellular location | Mitochondrion By similarity. |
| Sequence similarities | Belongs to the methyltransferase superfamily. Rsm22 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Mitochondrion |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transit peptide |
| Molecular function | Methyltransferase Ribonucleoprotein Ribosomal protein Transferase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | translation Inferred from electronic annotation. Source: InterPro |
| Cellular_component | mitochondrion Inferred from electronic annotation. Source: UniProtKB-SubCell ribosomeInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | copper ion binding Inferred from electronic annotation. Source: InterPro methyltransferase activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ATXN1 | P54253 | 5 | EBI-749353,EBI-930964 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9H7H0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9H7H0-2) The sequence of this isoform differs from the canonical sequence as follows: 422-430: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9H7H0-3) The sequence of this isoform differs from the canonical sequence as follows: 423-456: DLYRCARVSSWGDLLPVLTPSAFPPSTAQDPSES → YGGCDQNQWD...VSSIYGSGSL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 19 | 19 | Mitochondrion Potential | ||||||
| Chain | 20 – 456 | 437 | Methyltransferase-like protein 17, mitochondrial | PRO_0000312163 | |||||
Natural variations | |||||||||
| Alternative sequence | 422 – 430 | 9 | Missing in isoform 2. | VSP_029720 | |||||
| Alternative sequence | 423 – 456 | 34 | DLYRC…DPSES → YGGCDQNQWDVAGSCSPRQH LFPQGFVSLCPCQLLGRSFT CAYSVCVSSIYGSGSL in isoform 3. | VSP_029721 | |||||
| Natural variant | 289 | 1 | G → A. Corresponds to variant rs2297717 [ dbSNP | Ensembl ]. | VAR_037422 | |||||
| Natural variant | 346 | 1 | A → P. Ref.2 Corresponds to variant rs2771350 [ dbSNP | Ensembl ]. | VAR_037423 | |||||
Experimental info | |||||||||
| Sequence conflict | 53 | 1 | P → S in AAK08200. Ref.1 | ||||||
| Sequence conflict | 318 | 1 | E → G in AAK08200. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human genomic sequence of a false p73 target gene." Zheng X., Chen X. Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 3). Tissue: Mammary cancer. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-346. Tissue: Adipose tissue. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Lung. |
| [5] | "Identification of 12 new yeast mitochondrial ribosomal proteins including 6 that have no prokaryotic homologues." Saveanu C., Fromont-Racine M., Harington A., Ricard F., Namane A., Jacquier A. J. Biol. Chem. 276:15861-15867(2001) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF321002 mRNA. Translation: AAK08200.1. AF321003 Genomic DNA. Translation: AAK08201.1. AK024512 mRNA. Translation: BAB14919.1. CH471078 Genomic DNA. Translation: EAW66433.1. CH471078 Genomic DNA. Translation: EAW66434.1. BC005053 mRNA. Translation: AAH05053.1. |
| IPI | IPI00289084. IPI00329663. IPI00876996. |
| RefSeq | NP_001025162.1. NM_001029991.1. NP_073571.1. NM_022734.2. |
| UniGene | Hs.512693. |
3D structure databases | |
| ProteinModelPortal | Q9H7H0. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9H7H0. 2 interactions. |
| MINT | MINT-2875825. |
| STRING | 9606.ENSP00000372445. |
PTM databases | |
| PhosphoSite | Q9H7H0. |
Polymorphism databases | |
| DMDM | 74718673. |
Proteomic databases | |
| PaxDb | Q9H7H0. |
| PRIDE | Q9H7H0. |
Protocols and materials databases | |
| DNASU | 64745. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000339374; ENSP00000343041; ENSG00000165792. ENST00000382985; ENSP00000372445; ENSG00000165792. |
| GeneID | 64745. |
| KEGG | hsa:64745. |
| UCSC | uc001vym.3. human. uc001vyn.3. human. uc001vyo.3. human. |
Organism-specific databases | |
| CTD | 64745. |
| GeneCards | GC14P021458. |
| H-InvDB | HIX0011497. |
| HGNC | HGNC:19280. METTL17. |
| HPA | HPA002955. |
| neXtProt | NX_Q9H7H0. |
| PharmGKB | PA145008140. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5459. |
| HOVERGEN | HBG061595. |
| OMA | NRWPRIT. |
| OrthoDB | EOG4RJG1K. |
| PhylomeDB | Q9H7H0. |
Gene expression databases | |
| ArrayExpress | Q9H7H0. |
| Bgee | Q9H7H0. |
| CleanEx | HS_METT11D1. |
| Genevestigator | Q9H7H0. |
Family and domain databases | |
| InterPro | IPR007533. Cyt_c_oxidase_assmbl_CtaG. IPR015324. Ribosomal_Rsm22_bac-type. [Graphical view] |
| PANTHER | PTHR21320. PTHR21320. 1 hit. |
| Pfam | PF09243. Rsm22. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | METTL17. human. |
| GenomeRNAi | 64745. |
| NextBio | 66691. |
Entry information
| Entry name | MET17_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H7H0 Secondary accession number(s): Q9BSH1, Q9BZH2, Q9BZH3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
