Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SH2 domain-containing protein 4A

Gene

SH2D4A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Inhibits estrogen-induced cell proliferation by competing with PLCG for binding to ESR1, blocking the effect of estrogen on PLCG and repressing estrogen-induced proliferation. May play a role in T-cell development and function.2 Publications

GO - Molecular functioni

  • phosphatase binding Source: UniProtKB

GO - Biological processi

  • negative regulation of phosphatase activity Source: UniProtKB

Enzyme and pathway databases

SignaLinkiQ9H788.

Names & Taxonomyi

Protein namesi
Recommended name:
SH2 domain-containing protein 4A
Alternative name(s):
Protein SH(2)A
Protein phosphatase 1 regulatory subunit 38
Gene namesi
Name:SH2D4A
Synonyms:PPP1R38, SH2A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:26102. SH2D4A.

Subcellular locationi

GO - Cellular componenti

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi63898.
OpenTargetsiENSG00000104611.
PharmGKBiPA134891945.

Polymorphism and mutation databases

BioMutaiSH2D4A.
DMDMi74725117.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002331331 – 454SH2 domain-containing protein 4AAdd BLAST454

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei118PhosphoserineBy similarity1
Modified residuei124PhosphoserineCombined sources1
Modified residuei261PhosphoserineCombined sources1
Modified residuei315PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9H788.
MaxQBiQ9H788.
PaxDbiQ9H788.
PeptideAtlasiQ9H788.
PRIDEiQ9H788.

PTM databases

iPTMnetiQ9H788.
PhosphoSitePlusiQ9H788.

Expressioni

Tissue specificityi

Ubiquitously expressed. Aberrantly expressed in some cancers.1 Publication

Gene expression databases

BgeeiENSG00000104611.
CleanExiHS_SH2D4A.
ExpressionAtlasiQ9H788. baseline and differential.
GenevisibleiQ9H788. HS.

Organism-specific databases

HPAiHPA001871.
HPA001919.

Interactioni

Subunit structurei

Interacts with ESR1.1 Publication

Binary interactionsi

Show more details

GO - Molecular functioni

  • phosphatase binding Source: UniProtKB

Protein-protein interaction databases

BioGridi121977. 58 interactors.
IntActiQ9H788. 64 interactors.
MINTiMINT-1474891.
STRINGi9606.ENSP00000265807.

Structurei

3D structure databases

ProteinModelPortaliQ9H788.
SMRiQ9H788.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini347 – 440SH2PROSITE-ProRule annotationAdd BLAST94

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi172 – 177Poly-Ser6

Keywords - Domaini

SH2 domain

Phylogenomic databases

eggNOGiENOG410IEFY. Eukaryota.
ENOG410XPPJ. LUCA.
GeneTreeiENSGT00570000079047.
HOGENOMiHOG000031527.
HOVERGENiHBG057918.
InParanoidiQ9H788.
KOiK17577.
OMAiPYDVLCN.
OrthoDBiEOG090B07JH.
PhylomeDBiQ9H788.
TreeFamiTF336893.

Family and domain databases

Gene3Di3.30.505.10. 1 hit.
InterProiView protein in InterPro
IPR000980. SH2.
PfamiView protein in Pfam
PF00017. SH2. 1 hit.
SMARTiView protein in SMART
SM00252. SH2. 1 hit.
SUPFAMiSSF55550. SSF55550. 1 hit.
PROSITEiView protein in PROSITE
PS50001. SH2. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H788-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLKQILSEMY IDPDLLAELS EEQKQILFFK MREEQIRRWK EREAAMERKE
60 70 80 90 100
SLPVKPRPKK ENGKSVHWKL GADKEVWVWV MGEHHLDKPY DVLCNEIIAE
110 120 130 140 150
RARLKAEQEA EEPRKTHSEE FTNSLKTKSQ YHDLQAPDNQ QTKDIWKKVA
160 170 180 190 200
EKEELEQGSR PAPTLEEEKI RSLSSSSRNI QQMLADSINR MKAYAFHQKK
210 220 230 240 250
ESMKKKQDEE INQIEEERTK QICKSWKEDS EWQASLRKSK AADEKRRSLA
260 270 280 290 300
KQAREDYKRL SLGAQKGRGG ERLQSPLRVP QKPERPPLPP KPQFLNSGAY
310 320 330 340 350
PQKPLRNQGV VRTLSSSAQE DIIRWFKEEQ LPLRAGYQKT SDTIAPWFHG
360 370 380 390 400
ILTLKKANEL LLSTGMPGSF LIRVSERIKG YALSYLSEDG CKHFLIDASA
410 420 430 440 450
DAYSFLGVDQ LQHATLADLV EYHKEEPITS LGKELLLYPC GQQDQLPDYL

ELFE
Length:454
Mass (Da):52,727
Last modified:March 1, 2001 - v1
Checksum:i2FC21D4E07FDA922
GO
Isoform 2 (identifier: Q9H788-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MLKQILSEMYIDPDLLAELSEEQKQILFFKMREEQIRRWKEREAAMERKESLPVKPRPKK → MWRVIEPPCPGAPST

Note: No experimental confirmation available.
Show »
Length:409
Mass (Da):46,978
Checksum:iE7EE9D96502188B4
GO

Sequence cautioni

The sequence AAH67117 differs from that shown. Reason: Frameshift at position 392.Curated
The sequence AAO41715 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAO41715 differs from that shown. Reason: Erroneous termination at position 455. Translated as stop.Curated
The sequence BAB14935 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti95N → T in BAB14935 (PubMed:14702039).Curated1
Sequence conflicti179N → T in AAO41715 (PubMed:12476414).Curated1
Sequence conflicti238K → R in AAO41715 (PubMed:12476414).Curated1
Sequence conflicti253A → V in AAO41715 (PubMed:12476414).Curated1
Sequence conflicti291K → E in BAB14935 (PubMed:14702039).Curated1
Sequence conflicti346P → S in AAO41715 (PubMed:12476414).Curated1
Sequence conflicti440C → R in BAB14935 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_051350209E → G1 PublicationCorresponds to variant dbSNP:rs35647122Ensembl.1
Natural variantiVAR_026055216E → G1 PublicationCorresponds to variant dbSNP:rs4921637Ensembl.1
Natural variantiVAR_026056263G → A1 PublicationCorresponds to variant dbSNP:rs877386Ensembl.1
Natural variantiVAR_051351275S → N1 PublicationCorresponds to variant dbSNP:rs34608771Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0427841 – 60MLKQI…PRPKK → MWRVIEPPCPGAPST in isoform 2. 1 PublicationAdd BLAST60

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024620 mRNA. Translation: BAB14935.1. Different initiation.
AK024799 mRNA. Translation: BAB15010.1.
AK293301 mRNA. Translation: BAG56822.1.
AC068880 Genomic DNA. No translation available.
BC014525 mRNA. Translation: AAH14525.2.
BC067117 mRNA. Translation: AAH67117.1. Frameshift.
BC082982 mRNA. Translation: AAH82982.1.
AY190323 mRNA. Translation: AAO41715.1. Sequence problems.
CCDSiCCDS55206.1. [Q9H788-2]
CCDS6009.1. [Q9H788-1]
RefSeqiNP_001167630.1. NM_001174159.1. [Q9H788-1]
NP_001167631.1. NM_001174160.1. [Q9H788-2]
NP_071354.2. NM_022071.3. [Q9H788-1]
UniGeneiHs.303208.

Genome annotation databases

EnsembliENST00000265807; ENSP00000265807; ENSG00000104611. [Q9H788-1]
ENST00000518040; ENSP00000429482; ENSG00000104611. [Q9H788-2]
ENST00000519207; ENSP00000428684; ENSG00000104611. [Q9H788-1]
GeneIDi63898.
KEGGihsa:63898.
UCSCiuc003wzb.4. human. [Q9H788-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024620 mRNA. Translation: BAB14935.1. Different initiation.
AK024799 mRNA. Translation: BAB15010.1.
AK293301 mRNA. Translation: BAG56822.1.
AC068880 Genomic DNA. No translation available.
BC014525 mRNA. Translation: AAH14525.2.
BC067117 mRNA. Translation: AAH67117.1. Frameshift.
BC082982 mRNA. Translation: AAH82982.1.
AY190323 mRNA. Translation: AAO41715.1. Sequence problems.
CCDSiCCDS55206.1. [Q9H788-2]
CCDS6009.1. [Q9H788-1]
RefSeqiNP_001167630.1. NM_001174159.1. [Q9H788-1]
NP_001167631.1. NM_001174160.1. [Q9H788-2]
NP_071354.2. NM_022071.3. [Q9H788-1]
UniGeneiHs.303208.

3D structure databases

ProteinModelPortaliQ9H788.
SMRiQ9H788.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121977. 58 interactors.
IntActiQ9H788. 64 interactors.
MINTiMINT-1474891.
STRINGi9606.ENSP00000265807.

PTM databases

iPTMnetiQ9H788.
PhosphoSitePlusiQ9H788.

Polymorphism and mutation databases

BioMutaiSH2D4A.
DMDMi74725117.

Proteomic databases

EPDiQ9H788.
MaxQBiQ9H788.
PaxDbiQ9H788.
PeptideAtlasiQ9H788.
PRIDEiQ9H788.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265807; ENSP00000265807; ENSG00000104611. [Q9H788-1]
ENST00000518040; ENSP00000429482; ENSG00000104611. [Q9H788-2]
ENST00000519207; ENSP00000428684; ENSG00000104611. [Q9H788-1]
GeneIDi63898.
KEGGihsa:63898.
UCSCiuc003wzb.4. human. [Q9H788-1]

Organism-specific databases

CTDi63898.
DisGeNETi63898.
GeneCardsiSH2D4A.
HGNCiHGNC:26102. SH2D4A.
HPAiHPA001871.
HPA001919.
MIMi614968. gene.
neXtProtiNX_Q9H788.
OpenTargetsiENSG00000104611.
PharmGKBiPA134891945.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IEFY. Eukaryota.
ENOG410XPPJ. LUCA.
GeneTreeiENSGT00570000079047.
HOGENOMiHOG000031527.
HOVERGENiHBG057918.
InParanoidiQ9H788.
KOiK17577.
OMAiPYDVLCN.
OrthoDBiEOG090B07JH.
PhylomeDBiQ9H788.
TreeFamiTF336893.

Enzyme and pathway databases

SignaLinkiQ9H788.

Miscellaneous databases

ChiTaRSiSH2D4A. human.
GeneWikiiSH2D4A.
GenomeRNAii63898.
PROiQ9H788.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000104611.
CleanExiHS_SH2D4A.
ExpressionAtlasiQ9H788. baseline and differential.
GenevisibleiQ9H788. HS.

Family and domain databases

Gene3Di3.30.505.10. 1 hit.
InterProiView protein in InterPro
IPR000980. SH2.
PfamiView protein in Pfam
PF00017. SH2. 1 hit.
SMARTiView protein in SMART
SM00252. SH2. 1 hit.
SUPFAMiSSF55550. SSF55550. 1 hit.
PROSITEiView protein in PROSITE
PS50001. SH2. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiSH24A_HUMAN
AccessioniPrimary (citable) accession number: Q9H788
Secondary accession number(s): B4DDR1
, Q5XKC1, Q6NXE9, Q86YM2, Q96C88, Q9H7F7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: March 1, 2001
Last modified: February 15, 2017
This is version 131 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.