Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

PDZ domain-containing protein MAGIX

Gene

MAGIX

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at protein leveli

Functioni

Enzyme and pathway databases

BioCyciZFISH:ENSG00000017621-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
PDZ domain-containing protein MAGIX
Gene namesi
Name:MAGIX
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Unplaced

Organism-specific databases

HGNCiHGNC:30006. MAGIX.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162394882.

Polymorphism and mutation databases

DMDMi209572736.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003105421 – 334PDZ domain-containing protein MAGIXAdd BLAST334

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei272PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9H6Y5.
PeptideAtlasiQ9H6Y5.
PRIDEiQ9H6Y5.

PTM databases

iPTMnetiQ9H6Y5.
PhosphoSitePlusiQ9H6Y5.

Expressioni

Gene expression databases

BgeeiENSG00000017621.
CleanExiHS_MAGIX.

Organism-specific databases

HPAiHPA035302.

Interactioni

Protein-protein interaction databases

BioGridi122995. 23 interactors.
STRINGi9606.ENSP00000387928.

Structurei

Secondary structure

1334
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi124 – 129Combined sources6
Beta strandi132 – 134Combined sources3
Beta strandi137 – 140Combined sources4
Beta strandi152 – 156Combined sources5
Helixi161 – 165Combined sources5
Beta strandi173 – 177Combined sources5
Helixi187 – 196Combined sources10
Beta strandi199 – 205Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DJTNMR-A119-209[»]
ProteinModelPortaliQ9H6Y5.
SMRiQ9H6Y5.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9H6Y5.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini125 – 209PDZPROSITE-ProRule annotationAdd BLAST85

Sequence similaritiesi

Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3209. Eukaryota.
COG5021. LUCA.
HOGENOMiHOG000081783.
HOVERGENiHBG108115.
InParanoidiQ9H6Y5.
PhylomeDBiQ9H6Y5.
TreeFamiTF315536.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
InterProiIPR030031. MAGIX.
IPR001478. PDZ.
[Graphical view]
PANTHERiPTHR10316:SF5. PTHR10316:SF5. 1 hit.
PfamiPF00595. PDZ. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiPS50106. PDZ. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H6Y5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEPRTGGAAN PKGSRGSRGP SPLAGPSARQ LLARLDARPL AARAAVDVAA
60 70 80 90 100
LVRRAGATLR LRRKEAVSVL DSADIEVTDS RLPHATIVDH RPQHRWLETC
110 120 130 140 150
NAPPQLIQGK AHSAPKPSQA SGHFSVELVR GYAGFGLTLG GGRDVAGDTP
160 170 180 190 200
LAVRGLLKDG PAQRCGRLEV GDVVLHINGE STQGLTHAQA VERIRAGGPQ
210 220 230 240 250
LHLVIRRPLE THPGKPRGVG EPRKGVVPSW PDRSPDPGGP EVTGSRSSST
260 270 280 290 300
SLVQHPPSRT TLKKTRGSPE PSPEAAADGP TVSPPERRAE DPNDQIPGSP
310 320 330
GPWLVPSEER LSRALGVRGA AQFAQEMAAG RRRH
Length:334
Mass (Da):35,217
Last modified:October 14, 2008 - v3
Checksum:iB9081B483134243C
GO
Isoform 2 (identifier: Q9H6Y5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-92: MEPRTGGAAN...PHATIVDHRP → MPLLWITGPRYHLILLSEASCLRANYVHLCPLF

Note: No experimental confirmation available.
Show »
Length:275
Mass (Da):29,421
Checksum:i10B6EF9F35DB7444
GO
Isoform 3 (identifier: Q9H6Y5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-92: MEPRTGGAAN...PHATIVDHRP → MPLLWITGPRYHLILLSEASCLRANYVHLCPLF
     227-231: Missing.

Show »
Length:270
Mass (Da):28,855
Checksum:i34F5A16BEE3BDAA5
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03707553R → H.Corresponds to variant rs5906744dbSNPEnsembl.1
Natural variantiVAR_047035112H → R.3 PublicationsCorresponds to variant rs5906744dbSNPEnsembl.1
Natural variantiVAR_047036173V → L.3 PublicationsCorresponds to variant rs5905720dbSNPEnsembl.1
Natural variantiVAR_047037323F → L.3 PublicationsCorresponds to variant rs4824462dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0293191 – 92MEPRT…VDHRP → MPLLWITGPRYHLILLSEAS CLRANYVHLCPLF in isoform 2 and isoform 3. 2 PublicationsAdd BLAST92
Alternative sequenceiVSP_029320227 – 231Missing in isoform 3. 1 Publication5

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ884401 mRNA. Translation: ABI63368.1.
AK025340 mRNA. Translation: BAB15115.1.
AF196779 Genomic DNA. No translation available.
CH471224 Genomic DNA. Translation: EAW50691.1.
CCDSiCCDS48106.1. [Q9H6Y5-1]
RefSeqiNP_001093151.2. NM_001099681.2.
NP_001093152.2. NM_001099682.2.
NP_079135.3. NM_024859.3.
XP_005278121.1. XM_005278064.4.
XP_005278122.1. XM_005278065.3.
XP_011542287.1. XM_011543985.2.
XP_011542288.1. XM_011543986.2.
XP_011542289.1. XM_011543987.2.
UniGeneiHs.193170.

Genome annotation databases

GeneIDi79917.
KEGGihsa:79917.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ884401 mRNA. Translation: ABI63368.1.
AK025340 mRNA. Translation: BAB15115.1.
AF196779 Genomic DNA. No translation available.
CH471224 Genomic DNA. Translation: EAW50691.1.
CCDSiCCDS48106.1. [Q9H6Y5-1]
RefSeqiNP_001093151.2. NM_001099681.2.
NP_001093152.2. NM_001099682.2.
NP_079135.3. NM_024859.3.
XP_005278121.1. XM_005278064.4.
XP_005278122.1. XM_005278065.3.
XP_011542287.1. XM_011543985.2.
XP_011542288.1. XM_011543986.2.
XP_011542289.1. XM_011543987.2.
UniGeneiHs.193170.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DJTNMR-A119-209[»]
ProteinModelPortaliQ9H6Y5.
SMRiQ9H6Y5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122995. 23 interactors.
STRINGi9606.ENSP00000387928.

PTM databases

iPTMnetiQ9H6Y5.
PhosphoSitePlusiQ9H6Y5.

Polymorphism and mutation databases

DMDMi209572736.

Proteomic databases

PaxDbiQ9H6Y5.
PeptideAtlasiQ9H6Y5.
PRIDEiQ9H6Y5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi79917.
KEGGihsa:79917.

Organism-specific databases

CTDi79917.
GeneCardsiMAGIX.
HGNCiHGNC:30006. MAGIX.
HPAiHPA035302.
neXtProtiNX_Q9H6Y5.
PharmGKBiPA162394882.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3209. Eukaryota.
COG5021. LUCA.
HOGENOMiHOG000081783.
HOVERGENiHBG108115.
InParanoidiQ9H6Y5.
PhylomeDBiQ9H6Y5.
TreeFamiTF315536.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000017621-MONOMER.

Miscellaneous databases

EvolutionaryTraceiQ9H6Y5.
GenomeRNAii79917.
PROiQ9H6Y5.

Gene expression databases

BgeeiENSG00000017621.
CleanExiHS_MAGIX.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
InterProiIPR030031. MAGIX.
IPR001478. PDZ.
[Graphical view]
PANTHERiPTHR10316:SF5. PTHR10316:SF5. 1 hit.
PfamiPF00595. PDZ. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiPS50106. PDZ. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMAGIX_HUMAN
AccessioniPrimary (citable) accession number: Q9H6Y5
Secondary accession number(s): A6XND4
, A8MSX9, B7WP26, Q14C81
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: October 14, 2008
Last modified: November 2, 2016
This is version 99 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.