Q9H6Y5 (MAGIX_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 63.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: PDZ domain-containing protein MAGIX | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 334 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Sequence similarities | Contains 1 PDZ (DHR) domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9H6Y5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9H6Y5-2) The sequence of this isoform differs from the canonical sequence as follows: 1-92: MEPRTGGAAN...PHATIVDHRP → MPLLWITGPRYHLILLSEASCLRANYVHLCPLF | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9H6Y5-3) The sequence of this isoform differs from the canonical sequence as follows: 1-92: MEPRTGGAAN...PHATIVDHRP → MPLLWITGPRYHLILLSEASCLRANYVHLCPLF 227-231: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 334 | 334 | PDZ domain-containing protein MAGIX | PRO_0000310542 | |||||||||||||||||||||
Regions | |||||||||||||||||||||||||
| Domain | 125 – 209 | 85 | PDZ | ||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||
| Modified residue | 272 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||
| Alternative sequence | 1 – 92 | 92 | MEPRT…VDHRP → MPLLWITGPRYHLILLSEAS CLRANYVHLCPLF in isoform 2 and isoform 3. | VSP_029319 | |||||||||||||||||||||
| Alternative sequence | 227 – 231 | 5 | Missing in isoform 3. | VSP_029320 | |||||||||||||||||||||
| Natural variant | 53 | 1 | R → H. Corresponds to variant rs5906744 [ dbSNP | Ensembl ]. | VAR_037075 | |||||||||||||||||||||
| Natural variant | 112 | 1 | H → R. Ref.1 Ref.2 Ref.4 Corresponds to variant rs5906744 [ dbSNP | Ensembl ]. | VAR_047035 | |||||||||||||||||||||
| Natural variant | 173 | 1 | V → L. Ref.1 Ref.2 Ref.4 Corresponds to variant rs5905720 [ dbSNP | Ensembl ]. | VAR_047036 | |||||||||||||||||||||
| Natural variant | 323 | 1 | F → L. Ref.1 Ref.2 Ref.4 Corresponds to variant rs4824462 [ dbSNP | Ensembl ]. | VAR_047037 | |||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||
| Beta strand | 124 – 129 | 6 | |||||||||||||||||||||||
| Beta strand | 132 – 134 | 3 | |||||||||||||||||||||||
| Beta strand | 137 – 140 | 4 | |||||||||||||||||||||||
| Beta strand | 152 – 156 | 5 | |||||||||||||||||||||||
| Helix | 161 – 165 | 5 | |||||||||||||||||||||||
| Beta strand | 173 – 177 | 5 | |||||||||||||||||||||||
| Helix | 187 – 196 | 10 | |||||||||||||||||||||||
| Beta strand | 199 – 205 | 7 | |||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A computer system platform used to predict novel genes." Yu Z., Zheng Z., Tang T., Fu Y. Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), VARIANTS ARG-112; LEU-173 AND LEU-323. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS ARG-112; LEU-173 AND LEU-323. Tissue: Colon. |
| [3] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed: 15772651] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANTS ARG-112; LEU-173 AND LEU-323. |
| [5] | "Solution structures of the PDZ domain of human unnamed protein product." RIKEN structural genomics initiative (RSGI) Submitted (OCT-2006) to the PDB data bank Cited for: STRUCTURE BY NMR OF 59-150. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | DQ884401 mRNA. Translation: ABI63368.1. AK025340 mRNA. Translation: BAB15115.1. AF196779 Genomic DNA. No translation available. CH471224 Genomic DNA. Translation: EAW50691.1. | ||||||||||||
| IPI | IPI00016344. IPI00647032. IPI00871845. | ||||||||||||
| RefSeq | NP_001093150.1. NM_001099680.1. NP_001093151.1. NM_001099681.1. NP_001093152.1. NM_001099682.1. NP_079135.2. NM_024859.2. | ||||||||||||
| UniGene | Hs.193170. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9H6Y5. | ||||||||||||
| SMR | Q9H6Y5. Positions 19-62, 123-209. | ||||||||||||
| ModBase | Search... | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9H6Y5. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 209572736. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q9H6Y5. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000376338; ENSP00000365516; ENSG00000017621. ENST00000399915; ENSP00000382799; ENSG00000017621. ENST00000412696; ENSP00000387928; ENSG00000017621. | ||||||||||||
| GeneID | 79917. | ||||||||||||
| KEGG | hsa:79917. | ||||||||||||
| UCSC | uc004dmu.2. human. uc010nin.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 79917. | ||||||||||||
| GeneCards | GC0XP049019. | ||||||||||||
| HGNC | HGNC:30006. MAGIX. | ||||||||||||
| HPA | HPA035302. | ||||||||||||
| neXtProt | NX_Q9H6Y5. | ||||||||||||
| PharmGKB | PA162394882. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG17180. | ||||||||||||
| GeneTree | ENSGT00530000063259. | ||||||||||||
| HOGENOM | HBG507275. | ||||||||||||
| HOVERGEN | HBG108115. | ||||||||||||
| OMA | DQIPGSP. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9H6Y5. | ||||||||||||
| Bgee | Q9H6Y5. | ||||||||||||
| CleanEx | HS_MAGIX. | ||||||||||||
| Genevestigator | Q9H6Y5. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR001478. PDZ/DHR/GLGF. [Graphical view] | ||||||||||||
| Pfam | PF00595. PDZ. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00228. PDZ. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF50156. PDZ. 1 hit. | ||||||||||||
| PROSITE | PS50106. PDZ. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 69796. | ||||||||||||
Entry information
| Entry name | MAGIX_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H6Y5 Secondary accession number(s): A6XND4 Q14C81 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with