Reviewed,
UniProtKB/Swiss-Prot Q9H6X2 (ANTR1_HUMAN)
Last modified
March 2, 2010.
Version 99.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Anthrax toxin receptor 1 Alternative name(s): Tumor endothelial marker 8 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 564 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Plays a role in cell attachment and migration. Interacts with extracellular matrix proteins and with the actin cytoskeleton. Mediates adhesion of cells to type 1 collagen and gelatin, reorganization of the actin cytoskeleton and promotes cell spreading. Plays a role in the angiogenic response of cultured umbilical vein endothelial cells. Ref.9 Ref.10 |
| Subunit structure | Interacts with gelatin and type 1 collagen. Interacts with the actin cytoskeleton. Binds to the protective antigen (PA) of Bacillus anthracis. Binding does not occur in the presence of calcium. Ref.9 Ref.10 Ref.2 Ref.6 |
| Subcellular location | Cell membrane; Single-pass type I membrane protein. Cell projection › lamellipodium membrane; Single-pass type I membrane protein. Cell projection › filopodium membrane; Single-pass type I membrane protein. Note: At the membrane of lamellipodia and at the tip of actin-enriched filopodia. Colocalizes with actin at the base of lamellipodia. Ref.10 |
| Tissue specificity | Detected in umbilical vein endothelial cells (at protein level). Highly expressed in tumor endothelial cells. Ref.9 |
| Induction | Up-regulated in cultured angiogenic umbilical vein endothelial cells. Ref.9 |
| Domain | Binding to PA seems to be effected through the VWA domain. |
| Sequence similarities | Belongs to the ATR family. Contains 1 VWFA domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| LRP6 | O75581 | 1 | EBI-905643,EBI-910915 | |
| pagA | P13423 | 2 | EBI-905659,EBI-456868 | From a different organism. |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] Note: Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform 1 (identifier: Q9H6X2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 2 (identifier: Q9H6X2-2) The sequence of this isoform differs from the canonical sequence as follows: 365-368: EDDD → NKIK 369-564: Missing. | ||||||
| Isoform 3 (identifier: Q9H6X2-3) The sequence of this isoform differs from the canonical sequence as follows: 268-297: NEKPFSVEDTYLLCPAPILKEVGMKAALQV → SKSLQSPWVSSTSGFKEGNSHPCLPARPHT 298-564: Missing. | ||||||
| Isoform 4 (identifier: Q9H6X2-4) The sequence of this isoform differs from the canonical sequence as follows: 319-333: DGSILAIALLILFLL → LHKIASGPTTAACME 334-564: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 32 | 32 | Potential | ||||||
| Chain | 33 – 564 | 532 | Anthrax toxin receptor 1 | PRO_0000002692 | |||||
Regions | |||||||||
| Topological domain | 33 – 321 | 289 | Extracellular Potential | ||||||
| Transmembrane | 322 – 342 | 21 | Potential | ||||||
| Topological domain | 343 – 564 | 222 | Cytoplasmic Potential | ||||||
| Domain | 44 – 215 | 172 | VWFA | ||||||
| Compositional bias | 360 – 368 | 9 | Asp/Glu-rich (highly acidic) | ||||||
| Compositional bias | 506 – 564 | 59 | Pro-rich | ||||||
Sites | |||||||||
| Metal binding | 52 | 1 | Divalent metal cation By similarity | ||||||
| Metal binding | 54 | 1 | Divalent metal cation By similarity | ||||||
| Metal binding | 118 | 1 | Divalent metal cation By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 362 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 425 | 1 | Phosphotyrosine Ref.11 | ||||||
| Glycosylation | 166 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 184 | 1 | N-linked (GlcNAc...) Ref.12 | ||||||
| Glycosylation | 262 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 268 – 297 | 30 | NEKPF…AALQV → SKSLQSPWVSSTSGFKEGNS HPCLPARPHT in isoform 3. | VSP_000446 | |||||
| Alternative sequence | 298 – 564 | 267 | Missing in isoform 3. | VSP_000447 | |||||
| Alternative sequence | 319 – 333 | 15 | DGSIL…ILFLL → LHKIASGPTTAACME in isoform 4. | VSP_000448 | |||||
| Alternative sequence | 334 – 564 | 231 | Missing in isoform 4. | VSP_000449 | |||||
| Alternative sequence | 365 – 368 | 4 | EDDD → NKIK in isoform 2. | VSP_000444 | |||||
| Alternative sequence | 369 – 564 | 196 | Missing in isoform 2. | VSP_000445 | |||||
| Natural variant | 7 | 1 | R → K: dbSNP rs28365986. Ref.3 | VAR_053015 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Genes expressed in human tumor endothelium." St Croix B., Rago C., Velculescu V.E., Traverso G., Romans K.E., Montgomery E., Lal A., Riggins G.J., Lengauer C., Vogelstein B., Kinzler K.W. Science 289:1197-1202(2000) [PubMed: 10947988] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Identification of the cellular receptor for anthrax toxin." Bradley K.A., Mogridge J., Mourez M., Collier R.J., Young J.A.T. Nature 414:225-229(2001) [PubMed: 11700562] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INTERACTION WITH ANTHRAX TOXIN. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 184-564 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4), VARIANT LYS-7. |
| [4] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Kidney. |
| [6] | "Human capillary morphogenesis protein 2 functions as an anthrax toxin receptor." Scobie H.M., Rainey G.J.A., Bradley K.A., Young J.A.T. Proc. Natl. Acad. Sci. U.S.A. 100:5170-5174(2003) [PubMed: 12700348] [Abstract] Cited for: INTERACTION WITH ANTHRAX TOXIN. Tissue: Placenta. |
| [7] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed: 14759258] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [8] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-362, MASS SPECTROMETRY. Tissue: Epithelium. |
| [9] | "TEM8 expression stimulates endothelial cell adhesion and migration by regulating cell-matrix interactions on collagen." Hotchkiss K.A., Basile C.M., Spring S.C., Bonuccelli G., Lisanti M.P., Terman B.I. Exp. Cell Res. 305:133-144(2005) [PubMed: 15777794] [Abstract] Cited for: FUNCTION, INDUCTION, INTERACTION WITH TYPE 1 COLLAGEN AND GELATIN, TISSUE SPECIFICITY. |
| [10] | "Anthrax toxin receptor 1/tumor endothelium marker 8 mediates cell spreading by coupling extracellular ligands to the actin cytoskeleton." Werner E., Kowalczyk A.P., Faundez V. J. Biol. Chem. 281:23227-23236(2006) [PubMed: 16762926] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH TYPE 1 COLLAGEN; THE ACTIN CYTOSKELETON AND BACILLUS ANTHRACIS PROTECTIVE ANTIGEN. |
| [11] | "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer." Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J., Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L., Mitchell J., Wetzel R., Macneill J., Ren J.M. Comb M.J.Cell 131:1190-1203(2007) [PubMed: 18083107] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-425, MASS SPECTROMETRY. |
| [12] | "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins." Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D. Nat. Biotechnol. 27:378-386(2009) [PubMed: 19349973] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-184, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF279145 mRNA. Translation: AAK52094.1. AF421380 mRNA. Translation: AAL26496.1. AK001463 mRNA. Translation: BAA91707.1. Frameshift. AK025429 mRNA. Translation: BAB15128.1. Different initiation. AK292113 mRNA. Translation: BAF84802.1. AC112230 Genomic DNA. Translation: AAX88860.1. AC114802 Genomic DNA. Translation: AAY24067.1. BC012074 mRNA. Translation: AAH12074.1. |
| IPI | IPI00030431. IPI00071177. IPI00219619. IPI00871735. |
| RefSeq | NP_060623.2. NP_115584.1. NP_444262.1. |
| UniGene | Hs.165859 |
3D structure databases | |
| SMR | Q9H6X2. Positions 41-321. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9H6X2. 2 interactions. |
| STRING | Q9H6X2. |
PTM databases | |
| PhosphoSite | Q9H6X2. |
Proteomic databases | |
| PRIDE | Q9H6X2. |
Genome annotation databases | |
| Ensembl | ENST00000303714; ENSP00000301945; ENSG00000169604; Homo sapiens. [Genome view] |
| GeneID | 84168. |
| KEGG | hsa:84168. |
| UCSC | uc002sfd.1. human. uc002sfe.1. human. uc002sff.1. human. uc002sfg.1. human. |
Organism-specific databases | |
| CTD | 84168. |
| GeneCards | GC02P069152. |
| H-InvDB | HIX0002125. |
| HGNC | HGNC:21014. ANTXR1. |
| MIM | 606410. gene. |
| PharmGKB | PA134956382. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | HBG443624. |
| HOVERGEN | HBG050514. |
| InParanoid | Q9H6X2. |
| OMA | QGGRRED. |
| OrthoDB | EOG90P6RX. |
| PhylomeDB | Q9H6X2. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | anthraxpathway. Cellular roles of Anthrax toxin. |
Gene expression databases | |
| ArrayExpress | Q9H6X2. |
| Bgee | Q9H6X2. |
| CleanEx | HS_ANTXR1. HS_ATR. |
| Genevestigator | Q9H6X2. |
| GermOnline | ENSG00000169604. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR017360. Anthrax_toxin_rcpt_2. IPR008399. Anthrax_toxin_rcpt_C. IPR008400. Anthrax_toxin_rcpt_extracel. IPR002035. VWF_A. [Graphical view] |
| Pfam | PF05586. Ant_C. 1 hit. PF05587. Anth_Ig. 1 hit. PF00092. VWA. 1 hit. [Graphical view] |
| PIRSF | PIRSF038023. Anthrax_toxin_receptor_2. 1 hit. |
| ProDom | PD377005. Anthrax_toxin_rcpt_C. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00327. VWA. 1 hit. [Graphical view] |
| PROSITE | PS50234. VWFA. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 73524. |
| SOURCE | Search... |
Entry information
| Entry name | ANTR1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H6X2 Secondary accession number(s): A8K7U8 Q9NVP3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


