Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Receptor expression-enhancing protein 4

Gene

REEP4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Microtubule-binding protein required to ensure proper cell division and nuclear envelope reassembly by sequestering the endoplasmic reticulum away from chromosomes during mitosis. Probably acts by clearing the endoplasmic reticulum membrane from metaphase chromosomes.1 Publication

GO - Molecular functioni

GO - Biological processi

  • cell division Source: UniProtKB-KW
  • mitotic nuclear division Source: UniProtKB-KW
  • mitotic nuclear envelope reassembly Source: UniProtKB
  • nuclear envelope organization Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Cell cycle, Cell division, Mitosis

Names & Taxonomyi

Protein namesi
Recommended name:
Receptor expression-enhancing protein 4
Gene namesi
Name:REEP4
Synonyms:C8orf20
ORF Names:PP432
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:26176. REEP4.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei1 – 2121HelicalSequence analysisAdd
BLAST
Transmembranei42 – 6221HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Microtubule

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134890554.

Polymorphism and mutation databases

BioMutaiREEP4.
DMDMi74733607.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 257257Receptor expression-enhancing protein 4PRO_0000101830Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei152 – 1521PhosphoserineCombined sources
Modified residuei194 – 1941PhosphoserineCombined sources
Modified residuei196 – 1961PhosphothreonineCombined sources
Modified residuei202 – 2021PhosphoserineCombined sources
Modified residuei250 – 2501PhosphothreonineCombined sources
Modified residuei253 – 2531PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9H6H4.
MaxQBiQ9H6H4.
PaxDbiQ9H6H4.
PeptideAtlasiQ9H6H4.
PRIDEiQ9H6H4.

PTM databases

iPTMnetiQ9H6H4.
PhosphoSiteiQ9H6H4.

Expressioni

Tissue specificityi

Expressed in circumvallate papillae and testis.1 Publication

Gene expression databases

BgeeiENSG00000168476.
CleanExiHS_REEP4.
ExpressionAtlasiQ9H6H4. baseline and differential.
GenevisibleiQ9H6H4. HS.

Organism-specific databases

HPAiHPA042683.

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi123253. 20 interactions.
IntActiQ9H6H4. 7 interactions.
MINTiMINT-3976379.
STRINGi9606.ENSP00000303482.

Structurei

3D structure databases

ProteinModelPortaliQ9H6H4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the DP1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1726. Eukaryota.
COG5052. LUCA.
GeneTreeiENSGT00550000074535.
HOGENOMiHOG000007472.
HOVERGENiHBG056861.
InParanoidiQ9H6H4.
KOiK17338.
OrthoDBiEOG091G0X58.
PhylomeDBiQ9H6H4.
TreeFamiTF314177.

Family and domain databases

InterProiIPR004345. TB2_DP1_HVA22.
[Graphical view]
PANTHERiPTHR12300. PTHR12300. 1 hit.
PfamiPF03134. TB2_DP1_HVA22. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H6H4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVSWMICRLV VLVFGMLCPA YASYKAVKTK NIREYVRWMM YWIVFALFMA
60 70 80 90 100
AEIVTDIFIS WFPFYYEIKM AFVLWLLSPY TKGASLLYRK FVHPSLSRHE
110 120 130 140 150
KEIDAYIVQA KERSYETVLS FGKRGLNIAA SAAVQAATKS QGALAGRLRS
160 170 180 190 200
FSMQDLRSIS DAPAPAYHDP LYLEDQVSHR RPPIGYRAGG LQDSDTEDEC
210 220 230 240 250
WSDTEAVPRA PARPREKPLI RSQSLRVVKR KPPVREGTSR SLKVRTRKKT

VPSDVDS
Length:257
Mass (Da):29,395
Last modified:March 1, 2001 - v1
Checksum:iEA7AB1B9EDB3DB1A
GO
Isoform 2 (identifier: Q9H6H4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     140-173: SQGALAGRLRSFSMQDLRSISDAPAPAYHDPLYL → GTGPGACRTATPRMSVGQILRQSPGRQPGPERSP
     174-257: Missing.

Show »
Length:173
Mass (Da):19,692
Checksum:i390DCD281BF07CB6
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti149 – 1491R → Q in AAG17256 (PubMed:15498874).Curated
Sequence conflicti241 – 2411S → P in BAB15274 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei140 – 17334SQGAL…DPLYL → GTGPGACRTATPRMSVGQIL RQSPGRQPGPERSP in isoform 2. 1 PublicationVSP_016636Add
BLAST
Alternative sequencei174 – 25784Missing in isoform 2. 1 PublicationVSP_016637Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY562242 mRNA. Translation: AAT70687.1.
AK025899 mRNA. Translation: BAB15274.1.
AK025930 mRNA. Translation: BAB15285.1.
AK172846 mRNA. Translation: BAD18810.1.
AF218014 mRNA. Translation: AAG17256.1.
CR457353 mRNA. Translation: CAG33634.1.
AC105206 Genomic DNA. No translation available.
CH471080 Genomic DNA. Translation: EAW63710.1.
CH471080 Genomic DNA. Translation: EAW63715.1.
BC013048 mRNA. Translation: AAH13048.1.
BC050622 mRNA. Translation: AAH50622.1.
CCDSiCCDS6024.1. [Q9H6H4-1]
RefSeqiNP_001303893.1. NM_001316964.1.
NP_001303894.1. NM_001316965.1. [Q9H6H4-2]
NP_079508.2. NM_025232.3. [Q9H6H4-1]
UniGeneiHs.289063.

Genome annotation databases

EnsembliENST00000306306; ENSP00000303482; ENSG00000168476. [Q9H6H4-1]
ENST00000334530; ENSP00000333889; ENSG00000168476. [Q9H6H4-2]
GeneIDi80346.
KEGGihsa:80346.
UCSCiuc003xau.2. human. [Q9H6H4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY562242 mRNA. Translation: AAT70687.1.
AK025899 mRNA. Translation: BAB15274.1.
AK025930 mRNA. Translation: BAB15285.1.
AK172846 mRNA. Translation: BAD18810.1.
AF218014 mRNA. Translation: AAG17256.1.
CR457353 mRNA. Translation: CAG33634.1.
AC105206 Genomic DNA. No translation available.
CH471080 Genomic DNA. Translation: EAW63710.1.
CH471080 Genomic DNA. Translation: EAW63715.1.
BC013048 mRNA. Translation: AAH13048.1.
BC050622 mRNA. Translation: AAH50622.1.
CCDSiCCDS6024.1. [Q9H6H4-1]
RefSeqiNP_001303893.1. NM_001316964.1.
NP_001303894.1. NM_001316965.1. [Q9H6H4-2]
NP_079508.2. NM_025232.3. [Q9H6H4-1]
UniGeneiHs.289063.

3D structure databases

ProteinModelPortaliQ9H6H4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123253. 20 interactions.
IntActiQ9H6H4. 7 interactions.
MINTiMINT-3976379.
STRINGi9606.ENSP00000303482.

PTM databases

iPTMnetiQ9H6H4.
PhosphoSiteiQ9H6H4.

Polymorphism and mutation databases

BioMutaiREEP4.
DMDMi74733607.

Proteomic databases

EPDiQ9H6H4.
MaxQBiQ9H6H4.
PaxDbiQ9H6H4.
PeptideAtlasiQ9H6H4.
PRIDEiQ9H6H4.

Protocols and materials databases

DNASUi80346.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000306306; ENSP00000303482; ENSG00000168476. [Q9H6H4-1]
ENST00000334530; ENSP00000333889; ENSG00000168476. [Q9H6H4-2]
GeneIDi80346.
KEGGihsa:80346.
UCSCiuc003xau.2. human. [Q9H6H4-1]

Organism-specific databases

CTDi80346.
GeneCardsiREEP4.
HGNCiHGNC:26176. REEP4.
HPAiHPA042683.
MIMi609349. gene.
neXtProtiNX_Q9H6H4.
PharmGKBiPA134890554.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1726. Eukaryota.
COG5052. LUCA.
GeneTreeiENSGT00550000074535.
HOGENOMiHOG000007472.
HOVERGENiHBG056861.
InParanoidiQ9H6H4.
KOiK17338.
OrthoDBiEOG091G0X58.
PhylomeDBiQ9H6H4.
TreeFamiTF314177.

Miscellaneous databases

ChiTaRSiREEP4. human.
GenomeRNAii80346.
PROiQ9H6H4.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000168476.
CleanExiHS_REEP4.
ExpressionAtlasiQ9H6H4. baseline and differential.
GenevisibleiQ9H6H4. HS.

Family and domain databases

InterProiIPR004345. TB2_DP1_HVA22.
[Graphical view]
PANTHERiPTHR12300. PTHR12300. 1 hit.
PfamiPF03134. TB2_DP1_HVA22. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiREEP4_HUMAN
AccessioniPrimary (citable) accession number: Q9H6H4
Secondary accession number(s): D3DSQ9
, Q86VL1, Q9H6I5, Q9HBP4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 20, 2005
Last sequence update: March 1, 2001
Last modified: September 7, 2016
This is version 115 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.