Q9H611 (PIF1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 76.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: ATP-dependent DNA helicase PIF1 EC=3.6.4.12 Alternative name(s): PIF1/RRM3 DNA helicase-like protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 641 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | DNA-dependent ATPase and DNA helicase inhibiting telomerase activity by unwinding DNA/RNA duplex formed by telomerase RNA and telomeric DNA in a 5' to 3' polarity. Negatively regulates telomere length and such inhibition requires its ATPase activity. Tightly cell cycle regulated and expressed in late S/G2 phase. Ref.1 Ref.5 |
| Catalytic activity | ATP + H2O = ADP + phosphate. |
| Subunit structure | Interacts with telomerase. Ref.5 |
| Subcellular location | |
| Tissue specificity | Weak ubiquitous expression. |
| Sequence similarities | Belongs to the helicase family. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9H611-1) Also known as: Isoform alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9H611-2) The sequence of this isoform differs from the canonical sequence as follows: 232-266: TGKSYLLKRILGSLPPTGTVATASTGVAACHIGGT → SGGREEVGGQWWGGIEEQGDLSNFAPVQEQGSHIC 267-641: Missing. | ||||||
| Isoform 3 (identifier: Q9H611-3) Also known as: Isoform beta; The sequence of this isoform differs from the canonical sequence as follows: 623-641: ESPDDDEAASDQENMDPIL → AAEGRGNEDR...FQGINSVWGH |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 641 | 641 | ATP-dependent DNA helicase PIF1 | PRO_0000089980 | |||||
Regions | |||||||||
| Nucleotide binding | 228 – 235 | 8 | ATP Potential | ||||||
| Region | 167 – 641 | 475 | Hydrolyzes ATP in the presence of both magnesium and single-stranded DNA; weak activity in the presence of RNA or double-stranded DNA; No unwinding activity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 27 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 151 | 1 | Phosphoserine Ref.6 Ref.7 Ref.8 | ||||||
Natural variations | |||||||||
| Alternative sequence | 232 – 266 | 35 | TGKSY…HIGGT → SGGREEVGGQWWGGIEEQGD LSNFAPVQEQGSHIC in isoform 2. | VSP_026715 | |||||
| Alternative sequence | 267 – 641 | 375 | Missing in isoform 2. | VSP_026716 | |||||
| Alternative sequence | 623 – 641 | 19 | ESPDD…MDPIL → AAEGRGNEDRCSGSSIRALG GDWWGLRLGAASKQRTELRC VSTARPSLAQPRTNTLQSLT KEHKLQNVHPYFKLLFQGIN SVWGH in isoform 3. | VSP_026717 | |||||
| Natural variant | 640 | 1 | I → N. Corresponds to variant rs17802279 [ dbSNP | Ensembl ]. | VAR_033206 | |||||
Experimental info | |||||||||
| Mutagenesis | 234 | 1 | K → A: Loss of ATPase activity. Lower activity for single-stranded DNA. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The human Pif1 helicase, a potential Escherichia coli RecD homologue, inhibits telomerase activity." Zhang D.-H., Zhou B., Huang Y., Xu L.-X., Zhou J.-Q. Nucleic Acids Res. 34:1393-1404(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, REGION, MUTAGENESIS OF LYS-234, SUBCELLULAR LOCATION. |
| [2] | Snow B.E., Erdmann N., Harrington L. Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Human PIF1 DNA helicase." Futami K., Furuichi Y., Shimamoto A. Submitted (JUL-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Small intestine. |
| [5] | "Human PIF helicase is cell cycle regulated and associates with telomerase." Mateyak M.K., Zakian V.A. Cell Cycle 5:2796-2804(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH TELOMERASE. |
| [6] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-151, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [7] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-27 AND SER-151, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-151, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | DQ437529 mRNA. Translation: ABD92708.1. AY498716 mRNA. Translation: AAS77398.1. AB185926 mRNA. Translation: BAE47454.1. AB185927 mRNA. Translation: BAE47455.1. AK026345 mRNA. Translation: BAB15456.1. |
| IPI | IPI00017925. IPI00746514. IPI00793711. |
| RefSeq | NP_079325.2. NM_025049.2. |
| UniGene | Hs.112160. |
3D structure databases | |
| ProteinModelPortal | Q9H611. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000268043. |
PTM databases | |
| PhosphoSite | Q9H611. |
Polymorphism databases | |
| DMDM | 152031656. |
Proteomic databases | |
| PaxDb | Q9H611. |
| PRIDE | Q9H611. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000268043; ENSP00000268043; ENSG00000140451. ENST00000333425; ENSP00000328174; ENSG00000140451. ENST00000559239; ENSP00000452792; ENSG00000140451. |
| GeneID | 80119. |
| KEGG | hsa:80119. |
| UCSC | uc002ans.2. human. uc002anu.3. human. |
Organism-specific databases | |
| CTD | 80119. |
| GeneCards | GC15M065107. |
| H-InvDB | HIX0017918. |
| HGNC | HGNC:26220. PIF1. |
| HPA | CAB018701. |
| MIM | 610953. gene. |
| neXtProt | NX_Q9H611. |
| PharmGKB | PA162399475. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0507. |
| HOGENOM | HOG000132960. |
| HOVERGEN | HBG106706. |
| KO | K15255. |
| OMA | TEAPRWP. |
| OrthoDB | EOG4S4PFR. |
Gene expression databases | |
| ArrayExpress | Q9H611. |
| Bgee | Q9H611. |
| CleanEx | HS_PIF1. |
| Genevestigator | Q9H611. |
| GermOnline | ENSG00000140451. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR003840. DNA_helicase. IPR010285. DNA_helicase_PIF1. [Graphical view] |
| Pfam | PF02689. Herpes_Helicase. 1 hit. PF05970. PIF1. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 80119. |
| NextBio | 70350. |
| SOURCE | Search... |
Entry information
| Entry name | PIF1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H611 Secondary accession number(s): Q1W5B6, Q330H5, Q33E24 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
