Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MIP18 family protein FAM96A

Gene

FAM96A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May play a role in chromosome segregation through establishment of sister chromatid cohesion.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi89 – 891Zinc 1; shared with dimeric partner
Metal bindingi89 – 891Zinc 2; shared with dimeric partner
Metal bindingi123 – 1231Zinc 1; shared with dimeric partner
Metal bindingi123 – 1231Zinc 2; shared with dimeric partner
Metal bindingi150 – 1501Zinc 1; shared with dimeric partner
Metal bindingi150 – 1501Zinc 2; shared with dimeric partner
Metal bindingi153 – 1531Zinc 1; shared with dimeric partner
Metal bindingi153 – 1531Zinc 2; shared with dimeric partner

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Chromosome partition

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
MIP18 family protein FAM96A
Gene namesi
Name:FAM96A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:26235. FAM96A.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671829.

Polymorphism and mutation databases

BioMutaiFAM96A.
DMDMi20455359.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 160160MIP18 family protein FAM96APRO_0000212689Add
BLAST

Proteomic databases

MaxQBiQ9H5X1.
PaxDbiQ9H5X1.
PRIDEiQ9H5X1.

PTM databases

PhosphoSiteiQ9H5X1.

Expressioni

Tissue specificityi

Substantially enriched in macrophages.1 Publication

Gene expression databases

BgeeiQ9H5X1.
CleanExiHS_FAM96A.
ExpressionAtlasiQ9H5X1. baseline and differential.
GenevisibleiQ9H5X1. HS.

Organism-specific databases

HPAiHPA040459.

Interactioni

Subunit structurei

Monomer and homodimer. Interacts with CIAO1.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
CIAO1O760716EBI-752069,EBI-725145

Protein-protein interaction databases

BioGridi123939. 10 interactions.
IntActiQ9H5X1. 1 interaction.
MINTiMINT-1435495.
STRINGi9606.ENSP00000300030.

Structurei

Secondary structure

1
160
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi31 – 4414Combined sources
Beta strandi50 – 556Combined sources
Turni56 – 605Combined sources
Helixi64 – 663Combined sources
Beta strandi67 – 737Combined sources
Beta strandi76 – 816Combined sources
Beta strandi86 – 883Combined sources
Helixi92 – 10716Combined sources
Beta strandi112 – 1209Combined sources
Beta strandi122 – 1243Combined sources
Helixi129 – 1346Combined sources
Helixi136 – 1449Combined sources
Helixi146 – 15611Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2M5HNMR-A28-160[»]
3UX2X-ray1.80A31-157[»]
3UX3X-ray1.80A/B31-157[»]
ProteinModelPortaliQ9H5X1.
SMRiQ9H5X1. Positions 28-160.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the MIP18 family.Curated

Phylogenomic databases

eggNOGiCOG5133.
GeneTreeiENSGT00390000017697.
HOGENOMiHOG000082425.
HOVERGENiHBG029509.
InParanoidiQ9H5X1.
OMAiLCLRIKL.
OrthoDBiEOG7034J5.
PhylomeDBiQ9H5X1.
TreeFamiTF323934.

Family and domain databases

InterProiIPR002744. DUF59.
[Graphical view]
PfamiPF01883. DUF59. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H5X1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQRVSGLLSW TLSRVLWLSG LSEPGAARQP RIMEEKALEV YDLIRTIRDP
60 70 80 90 100
EKPNTLEELE VVSESCVEVQ EINEEEYLVI IRFTPTVPHC SLATLIGLCL
110 120 130 140 150
RVKLQRCLPF KHKLEIYISE GTHSTEEDIN KQINDKERVA AAMENPNLRE
160
IVEQCVLEPD
Length:160
Mass (Da):18,355
Last modified:March 1, 2001 - v1
Checksum:i8580E4E397067319
GO
Isoform 2 (identifier: Q9H5X1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     97-160: GLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD → VGNLHF

Note: No experimental confirmation available.
Show »
Length:102
Mass (Da):11,634
Checksum:i09416E6149875BE1
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei97 – 16064GLCLR…VLEPD → VGNLHF in isoform 2. 1 PublicationVSP_042683Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK026528 mRNA. Translation: BAB15496.1.
AK304202 mRNA. Translation: BAH14131.1.
AK312171 mRNA. Translation: BAG35105.1.
AC021541 Genomic DNA. No translation available.
CH471082 Genomic DNA. Translation: EAW77661.1.
CH471082 Genomic DNA. Translation: EAW77662.1.
BC008865 mRNA. Translation: AAH08865.1.
CCDSiCCDS10189.1. [Q9H5X1-1]
CCDS45278.1. [Q9H5X1-2]
RefSeqiNP_001014812.1. NM_001014812.2. [Q9H5X1-2]
NP_001276037.1. NM_001289108.1. [Q9H5X1-2]
NP_115607.1. NM_032231.5. [Q9H5X1-1]
UniGeneiHs.439548.

Genome annotation databases

EnsembliENST00000300030; ENSP00000300030; ENSG00000166797.
ENST00000380290; ENSP00000369644; ENSG00000166797. [Q9H5X1-2]
ENST00000557835; ENSP00000454079; ENSG00000166797. [Q9H5X1-2]
GeneIDi84191.
KEGGihsa:84191.
UCSCiuc002amt.1. human. [Q9H5X1-1]
uc002amu.1. human. [Q9H5X1-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK026528 mRNA. Translation: BAB15496.1.
AK304202 mRNA. Translation: BAH14131.1.
AK312171 mRNA. Translation: BAG35105.1.
AC021541 Genomic DNA. No translation available.
CH471082 Genomic DNA. Translation: EAW77661.1.
CH471082 Genomic DNA. Translation: EAW77662.1.
BC008865 mRNA. Translation: AAH08865.1.
CCDSiCCDS10189.1. [Q9H5X1-1]
CCDS45278.1. [Q9H5X1-2]
RefSeqiNP_001014812.1. NM_001014812.2. [Q9H5X1-2]
NP_001276037.1. NM_001289108.1. [Q9H5X1-2]
NP_115607.1. NM_032231.5. [Q9H5X1-1]
UniGeneiHs.439548.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2M5HNMR-A28-160[»]
3UX2X-ray1.80A31-157[»]
3UX3X-ray1.80A/B31-157[»]
ProteinModelPortaliQ9H5X1.
SMRiQ9H5X1. Positions 28-160.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123939. 10 interactions.
IntActiQ9H5X1. 1 interaction.
MINTiMINT-1435495.
STRINGi9606.ENSP00000300030.

PTM databases

PhosphoSiteiQ9H5X1.

Polymorphism and mutation databases

BioMutaiFAM96A.
DMDMi20455359.

Proteomic databases

MaxQBiQ9H5X1.
PaxDbiQ9H5X1.
PRIDEiQ9H5X1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000300030; ENSP00000300030; ENSG00000166797.
ENST00000380290; ENSP00000369644; ENSG00000166797. [Q9H5X1-2]
ENST00000557835; ENSP00000454079; ENSG00000166797. [Q9H5X1-2]
GeneIDi84191.
KEGGihsa:84191.
UCSCiuc002amt.1. human. [Q9H5X1-1]
uc002amu.1. human. [Q9H5X1-2]

Organism-specific databases

CTDi84191.
GeneCardsiGC15M064364.
H-InvDBHIX0012334.
HGNCiHGNC:26235. FAM96A.
HPAiHPA040459.
neXtProtiNX_Q9H5X1.
PharmGKBiPA142671829.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG5133.
GeneTreeiENSGT00390000017697.
HOGENOMiHOG000082425.
HOVERGENiHBG029509.
InParanoidiQ9H5X1.
OMAiLCLRIKL.
OrthoDBiEOG7034J5.
PhylomeDBiQ9H5X1.
TreeFamiTF323934.

Miscellaneous databases

ChiTaRSiFAM96A. human.
GenomeRNAii84191.
NextBioi73586.
PROiQ9H5X1.

Gene expression databases

BgeeiQ9H5X1.
CleanExiHS_FAM96A.
ExpressionAtlasiQ9H5X1. baseline and differential.
GenevisibleiQ9H5X1. HS.

Family and domain databases

InterProiIPR002744. DUF59.
[Graphical view]
PfamiPF01883. DUF59. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain and Trachea.
  2. "Analysis of the DNA sequence and duplication history of human chromosome 15."
    Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
    , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
    Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  6. "The mammalian DUF59 protein Fam96a forms two distinct types of domain-swapped dimer."
    Chen K.E., Richards A.A., Ariffin J.K., Ross I.L., Sweet M.J., Kellie S., Kobe B., Martin J.L.
    Acta Crystallogr. D 68:637-648(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 31-157, SUBUNIT, SUBCELLULAR LOCATION, ZINC-BINDING SITES, TISSUE SPECIFICITY.

Entry informationi

Entry nameiFA96A_HUMAN
AccessioniPrimary (citable) accession number: Q9H5X1
Secondary accession number(s): A6NKS1, B2R5F8, B7Z8Z5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 2, 2002
Last sequence update: March 1, 2001
Last modified: July 22, 2015
This is version 104 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.