Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9H5X1

- FA96A_HUMAN

UniProt

Q9H5X1 - FA96A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

MIP18 family protein FAM96A

Gene

FAM96A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

May play a role in chromosome segregation through establishment of sister chromatid cohesion.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi89 – 891Zinc 1; shared with dimeric partner
Metal bindingi89 – 891Zinc 2; shared with dimeric partner
Metal bindingi123 – 1231Zinc 1; shared with dimeric partner
Metal bindingi123 – 1231Zinc 2; shared with dimeric partner
Metal bindingi150 – 1501Zinc 1; shared with dimeric partner
Metal bindingi150 – 1501Zinc 2; shared with dimeric partner
Metal bindingi153 – 1531Zinc 1; shared with dimeric partner
Metal bindingi153 – 1531Zinc 2; shared with dimeric partner

GO - Molecular functioni

  1. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. chromosome segregation Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Chromosome partition

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
MIP18 family protein FAM96A
Gene namesi
Name:FAM96A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 15

Organism-specific databases

HGNCiHGNC:26235. FAM96A.

Subcellular locationi

Cytoplasm 1 Publication

GO - Cellular componenti

  1. cytoplasm Source: HPA
  2. nucleus Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671829.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 160160MIP18 family protein FAM96APRO_0000212689Add
BLAST

Proteomic databases

MaxQBiQ9H5X1.
PaxDbiQ9H5X1.
PRIDEiQ9H5X1.

PTM databases

PhosphoSiteiQ9H5X1.

Expressioni

Tissue specificityi

Substantially enriched in macrophages.1 Publication

Gene expression databases

BgeeiQ9H5X1.
CleanExiHS_FAM96A.
ExpressionAtlasiQ9H5X1. baseline and differential.
GenevestigatoriQ9H5X1.

Organism-specific databases

HPAiHPA040459.

Interactioni

Subunit structurei

Monomer and homodimer. Interacts with CIAO1.1 Publication

Protein-protein interaction databases

BioGridi123939. 11 interactions.
IntActiQ9H5X1. 1 interaction.
MINTiMINT-1435495.
STRINGi9606.ENSP00000300030.

Structurei

Secondary structure

1
160
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi31 – 4414
Beta strandi50 – 556
Turni56 – 605
Helixi64 – 663
Beta strandi67 – 737
Beta strandi76 – 816
Beta strandi86 – 883
Helixi92 – 10716
Beta strandi112 – 1209
Beta strandi122 – 1243
Helixi129 – 1346
Helixi136 – 1449
Helixi146 – 15611

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2M5HNMR-A28-160[»]
3UX2X-ray1.80A31-157[»]
3UX3X-ray1.80A/B31-157[»]
ProteinModelPortaliQ9H5X1.
SMRiQ9H5X1. Positions 28-160.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the MIP18 family.Curated

Phylogenomic databases

eggNOGiCOG5133.
GeneTreeiENSGT00390000017697.
HOGENOMiHOG000157065.
HOVERGENiHBG029509.
InParanoidiQ9H5X1.
OMAiQVKLQRC.
OrthoDBiEOG7034J5.
PhylomeDBiQ9H5X1.
TreeFamiTF323934.

Family and domain databases

InterProiIPR002744. DUF59.
[Graphical view]
PfamiPF01883. DUF59. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9H5X1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQRVSGLLSW TLSRVLWLSG LSEPGAARQP RIMEEKALEV YDLIRTIRDP
60 70 80 90 100
EKPNTLEELE VVSESCVEVQ EINEEEYLVI IRFTPTVPHC SLATLIGLCL
110 120 130 140 150
RVKLQRCLPF KHKLEIYISE GTHSTEEDIN KQINDKERVA AAMENPNLRE
160
IVEQCVLEPD
Length:160
Mass (Da):18,355
Last modified:March 1, 2001 - v1
Checksum:i8580E4E397067319
GO
Isoform 2 (identifier: Q9H5X1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     97-160: GLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD → VGNLHF

Note: No experimental confirmation available.

Show »
Length:102
Mass (Da):11,634
Checksum:i09416E6149875BE1
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei97 – 16064GLCLR…VLEPD → VGNLHF in isoform 2. 1 PublicationVSP_042683Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK026528 mRNA. Translation: BAB15496.1.
AK304202 mRNA. Translation: BAH14131.1.
AK312171 mRNA. Translation: BAG35105.1.
AC021541 Genomic DNA. No translation available.
CH471082 Genomic DNA. Translation: EAW77661.1.
CH471082 Genomic DNA. Translation: EAW77662.1.
BC008865 mRNA. Translation: AAH08865.1.
CCDSiCCDS10189.1. [Q9H5X1-1]
CCDS45278.1. [Q9H5X1-2]
RefSeqiNP_001014812.1. NM_001014812.2. [Q9H5X1-2]
NP_001276037.1. NM_001289108.1. [Q9H5X1-2]
NP_115607.1. NM_032231.5. [Q9H5X1-1]
UniGeneiHs.439548.

Genome annotation databases

EnsembliENST00000300030; ENSP00000300030; ENSG00000166797. [Q9H5X1-1]
ENST00000380290; ENSP00000369644; ENSG00000166797. [Q9H5X1-2]
ENST00000557835; ENSP00000454079; ENSG00000166797. [Q9H5X1-2]
GeneIDi84191.
KEGGihsa:84191.
UCSCiuc002amt.1. human. [Q9H5X1-1]
uc002amu.1. human. [Q9H5X1-2]

Polymorphism databases

DMDMi20455359.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK026528 mRNA. Translation: BAB15496.1 .
AK304202 mRNA. Translation: BAH14131.1 .
AK312171 mRNA. Translation: BAG35105.1 .
AC021541 Genomic DNA. No translation available.
CH471082 Genomic DNA. Translation: EAW77661.1 .
CH471082 Genomic DNA. Translation: EAW77662.1 .
BC008865 mRNA. Translation: AAH08865.1 .
CCDSi CCDS10189.1. [Q9H5X1-1 ]
CCDS45278.1. [Q9H5X1-2 ]
RefSeqi NP_001014812.1. NM_001014812.2. [Q9H5X1-2 ]
NP_001276037.1. NM_001289108.1. [Q9H5X1-2 ]
NP_115607.1. NM_032231.5. [Q9H5X1-1 ]
UniGenei Hs.439548.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2M5H NMR - A 28-160 [» ]
3UX2 X-ray 1.80 A 31-157 [» ]
3UX3 X-ray 1.80 A/B 31-157 [» ]
ProteinModelPortali Q9H5X1.
SMRi Q9H5X1. Positions 28-160.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 123939. 11 interactions.
IntActi Q9H5X1. 1 interaction.
MINTi MINT-1435495.
STRINGi 9606.ENSP00000300030.

PTM databases

PhosphoSitei Q9H5X1.

Polymorphism databases

DMDMi 20455359.

Proteomic databases

MaxQBi Q9H5X1.
PaxDbi Q9H5X1.
PRIDEi Q9H5X1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000300030 ; ENSP00000300030 ; ENSG00000166797 . [Q9H5X1-1 ]
ENST00000380290 ; ENSP00000369644 ; ENSG00000166797 . [Q9H5X1-2 ]
ENST00000557835 ; ENSP00000454079 ; ENSG00000166797 . [Q9H5X1-2 ]
GeneIDi 84191.
KEGGi hsa:84191.
UCSCi uc002amt.1. human. [Q9H5X1-1 ]
uc002amu.1. human. [Q9H5X1-2 ]

Organism-specific databases

CTDi 84191.
GeneCardsi GC15M064364.
H-InvDB HIX0012334.
HGNCi HGNC:26235. FAM96A.
HPAi HPA040459.
neXtProti NX_Q9H5X1.
PharmGKBi PA142671829.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5133.
GeneTreei ENSGT00390000017697.
HOGENOMi HOG000157065.
HOVERGENi HBG029509.
InParanoidi Q9H5X1.
OMAi QVKLQRC.
OrthoDBi EOG7034J5.
PhylomeDBi Q9H5X1.
TreeFami TF323934.

Miscellaneous databases

ChiTaRSi FAM96A. human.
GenomeRNAii 84191.
NextBioi 73586.
PROi Q9H5X1.

Gene expression databases

Bgeei Q9H5X1.
CleanExi HS_FAM96A.
ExpressionAtlasi Q9H5X1. baseline and differential.
Genevestigatori Q9H5X1.

Family and domain databases

InterProi IPR002744. DUF59.
[Graphical view ]
Pfami PF01883. DUF59. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain and Trachea.
  2. "Analysis of the DNA sequence and duplication history of human chromosome 15."
    Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
    , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
    Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. "The mammalian DUF59 protein Fam96a forms two distinct types of domain-swapped dimer."
    Chen K.E., Richards A.A., Ariffin J.K., Ross I.L., Sweet M.J., Kellie S., Kobe B., Martin J.L.
    Acta Crystallogr. D 68:637-648(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 31-157, SUBUNIT, SUBCELLULAR LOCATION, ZINC-BINDING SITES, TISSUE SPECIFICITY.

Entry informationi

Entry nameiFA96A_HUMAN
AccessioniPrimary (citable) accession number: Q9H5X1
Secondary accession number(s): A6NKS1, B2R5F8, B7Z8Z5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 2, 2002
Last sequence update: March 1, 2001
Last modified: October 29, 2014
This is version 96 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3