Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9H5X1

- FA96A_HUMAN

UniProt

Q9H5X1 - FA96A_HUMAN

Protein

MIP18 family protein FAM96A

Gene

FAM96A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
  1. Functioni

    May play a role in chromosome segregation through establishment of sister chromatid cohesion.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi89 – 891Zinc 1; shared with dimeric partner
    Metal bindingi89 – 891Zinc 2; shared with dimeric partner
    Metal bindingi123 – 1231Zinc 1; shared with dimeric partner
    Metal bindingi123 – 1231Zinc 2; shared with dimeric partner
    Metal bindingi150 – 1501Zinc 1; shared with dimeric partner
    Metal bindingi150 – 1501Zinc 2; shared with dimeric partner
    Metal bindingi153 – 1531Zinc 1; shared with dimeric partner
    Metal bindingi153 – 1531Zinc 2; shared with dimeric partner

    GO - Molecular functioni

    1. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. chromosome segregation Source: UniProtKB-KW

    Keywords - Biological processi

    Chromosome partition

    Keywords - Ligandi

    Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    MIP18 family protein FAM96A
    Gene namesi
    Name:FAM96A
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 15

    Organism-specific databases

    HGNCiHGNC:26235. FAM96A.

    Subcellular locationi

    Cytoplasm 1 Publication

    GO - Cellular componenti

    1. cytoplasm Source: HPA
    2. nucleus Source: HPA

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142671829.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 160160MIP18 family protein FAM96APRO_0000212689Add
    BLAST

    Proteomic databases

    MaxQBiQ9H5X1.
    PaxDbiQ9H5X1.
    PRIDEiQ9H5X1.

    PTM databases

    PhosphoSiteiQ9H5X1.

    Expressioni

    Tissue specificityi

    Substantially enriched in macrophages.1 Publication

    Gene expression databases

    ArrayExpressiQ9H5X1.
    BgeeiQ9H5X1.
    CleanExiHS_FAM96A.
    GenevestigatoriQ9H5X1.

    Organism-specific databases

    HPAiHPA040459.

    Interactioni

    Subunit structurei

    Monomer and homodimer. Interacts with CIAO1.1 Publication

    Protein-protein interaction databases

    BioGridi123939. 2 interactions.
    IntActiQ9H5X1. 1 interaction.
    MINTiMINT-1435495.
    STRINGi9606.ENSP00000300030.

    Structurei

    Secondary structure

    1
    160
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi31 – 4414
    Beta strandi50 – 556
    Turni56 – 605
    Helixi64 – 663
    Beta strandi67 – 737
    Beta strandi76 – 816
    Beta strandi86 – 883
    Helixi92 – 10716
    Beta strandi112 – 1209
    Beta strandi122 – 1243
    Helixi129 – 1346
    Helixi136 – 1449
    Helixi146 – 15611

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2M5HNMR-A28-160[»]
    3UX2X-ray1.80A31-157[»]
    3UX3X-ray1.80A/B31-157[»]
    ProteinModelPortaliQ9H5X1.
    SMRiQ9H5X1. Positions 28-160.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the MIP18 family.Curated

    Phylogenomic databases

    eggNOGiCOG5133.
    HOGENOMiHOG000157065.
    HOVERGENiHBG029509.
    InParanoidiQ9H5X1.
    OMAiQVKLQRC.
    OrthoDBiEOG7034J5.
    PhylomeDBiQ9H5X1.
    TreeFamiTF323934.

    Family and domain databases

    InterProiIPR002744. DUF59.
    [Graphical view]
    PfamiPF01883. DUF59. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9H5X1-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MQRVSGLLSW TLSRVLWLSG LSEPGAARQP RIMEEKALEV YDLIRTIRDP    50
    EKPNTLEELE VVSESCVEVQ EINEEEYLVI IRFTPTVPHC SLATLIGLCL 100
    RVKLQRCLPF KHKLEIYISE GTHSTEEDIN KQINDKERVA AAMENPNLRE 150
    IVEQCVLEPD 160
    Length:160
    Mass (Da):18,355
    Last modified:March 1, 2001 - v1
    Checksum:i8580E4E397067319
    GO
    Isoform 2 (identifier: Q9H5X1-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         97-160: GLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD → VGNLHF

    Note: No experimental confirmation available.

    Show »
    Length:102
    Mass (Da):11,634
    Checksum:i09416E6149875BE1
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei97 – 16064GLCLR…VLEPD → VGNLHF in isoform 2. 1 PublicationVSP_042683Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK026528 mRNA. Translation: BAB15496.1.
    AK304202 mRNA. Translation: BAH14131.1.
    AK312171 mRNA. Translation: BAG35105.1.
    AC021541 Genomic DNA. No translation available.
    CH471082 Genomic DNA. Translation: EAW77661.1.
    CH471082 Genomic DNA. Translation: EAW77662.1.
    BC008865 mRNA. Translation: AAH08865.1.
    CCDSiCCDS10189.1. [Q9H5X1-1]
    CCDS45278.1. [Q9H5X1-2]
    RefSeqiNP_001014812.1. NM_001014812.2. [Q9H5X1-2]
    NP_001276037.1. NM_001289108.1. [Q9H5X1-2]
    NP_115607.1. NM_032231.5. [Q9H5X1-1]
    UniGeneiHs.439548.

    Genome annotation databases

    EnsembliENST00000300030; ENSP00000300030; ENSG00000166797. [Q9H5X1-1]
    ENST00000380290; ENSP00000369644; ENSG00000166797. [Q9H5X1-2]
    ENST00000557835; ENSP00000454079; ENSG00000166797. [Q9H5X1-2]
    GeneIDi84191.
    KEGGihsa:84191.
    UCSCiuc002amt.1. human. [Q9H5X1-1]
    uc002amu.1. human. [Q9H5X1-2]

    Polymorphism databases

    DMDMi20455359.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK026528 mRNA. Translation: BAB15496.1 .
    AK304202 mRNA. Translation: BAH14131.1 .
    AK312171 mRNA. Translation: BAG35105.1 .
    AC021541 Genomic DNA. No translation available.
    CH471082 Genomic DNA. Translation: EAW77661.1 .
    CH471082 Genomic DNA. Translation: EAW77662.1 .
    BC008865 mRNA. Translation: AAH08865.1 .
    CCDSi CCDS10189.1. [Q9H5X1-1 ]
    CCDS45278.1. [Q9H5X1-2 ]
    RefSeqi NP_001014812.1. NM_001014812.2. [Q9H5X1-2 ]
    NP_001276037.1. NM_001289108.1. [Q9H5X1-2 ]
    NP_115607.1. NM_032231.5. [Q9H5X1-1 ]
    UniGenei Hs.439548.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2M5H NMR - A 28-160 [» ]
    3UX2 X-ray 1.80 A 31-157 [» ]
    3UX3 X-ray 1.80 A/B 31-157 [» ]
    ProteinModelPortali Q9H5X1.
    SMRi Q9H5X1. Positions 28-160.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 123939. 2 interactions.
    IntActi Q9H5X1. 1 interaction.
    MINTi MINT-1435495.
    STRINGi 9606.ENSP00000300030.

    PTM databases

    PhosphoSitei Q9H5X1.

    Polymorphism databases

    DMDMi 20455359.

    Proteomic databases

    MaxQBi Q9H5X1.
    PaxDbi Q9H5X1.
    PRIDEi Q9H5X1.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000300030 ; ENSP00000300030 ; ENSG00000166797 . [Q9H5X1-1 ]
    ENST00000380290 ; ENSP00000369644 ; ENSG00000166797 . [Q9H5X1-2 ]
    ENST00000557835 ; ENSP00000454079 ; ENSG00000166797 . [Q9H5X1-2 ]
    GeneIDi 84191.
    KEGGi hsa:84191.
    UCSCi uc002amt.1. human. [Q9H5X1-1 ]
    uc002amu.1. human. [Q9H5X1-2 ]

    Organism-specific databases

    CTDi 84191.
    GeneCardsi GC15M064364.
    H-InvDB HIX0012334.
    HGNCi HGNC:26235. FAM96A.
    HPAi HPA040459.
    neXtProti NX_Q9H5X1.
    PharmGKBi PA142671829.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5133.
    HOGENOMi HOG000157065.
    HOVERGENi HBG029509.
    InParanoidi Q9H5X1.
    OMAi QVKLQRC.
    OrthoDBi EOG7034J5.
    PhylomeDBi Q9H5X1.
    TreeFami TF323934.

    Miscellaneous databases

    ChiTaRSi FAM96A. human.
    GenomeRNAii 84191.
    NextBioi 73586.
    PROi Q9H5X1.

    Gene expression databases

    ArrayExpressi Q9H5X1.
    Bgeei Q9H5X1.
    CleanExi HS_FAM96A.
    Genevestigatori Q9H5X1.

    Family and domain databases

    InterProi IPR002744. DUF59.
    [Graphical view ]
    Pfami PF01883. DUF59. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain and Trachea.
    2. "Analysis of the DNA sequence and duplication history of human chromosome 15."
      Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
      , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
      Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    7. "The mammalian DUF59 protein Fam96a forms two distinct types of domain-swapped dimer."
      Chen K.E., Richards A.A., Ariffin J.K., Ross I.L., Sweet M.J., Kellie S., Kobe B., Martin J.L.
      Acta Crystallogr. D 68:637-648(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 31-157, SUBUNIT, SUBCELLULAR LOCATION, ZINC-BINDING SITES, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiFA96A_HUMAN
    AccessioniPrimary (citable) accession number: Q9H5X1
    Secondary accession number(s): A6NKS1, B2R5F8, B7Z8Z5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 2, 2002
    Last sequence update: March 1, 2001
    Last modified: October 1, 2014
    This is version 95 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 15
      Human chromosome 15: entries, gene names and cross-references to MIM
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3