Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9H5X1 (FA96A_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 91. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
MIP18 family protein FAM96A
Gene names
Name:FAM96A
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length160 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May play a role in chromosome segregation through establishment of sister chromatid cohesion By similarity.

Subunit structure

Monomer and homodimer. Interacts with CIAO1. Ref.7

Subcellular location

Cytoplasm Ref.7.

Tissue specificity

Substantially enriched in macrophages. Ref.7

Sequence similarities

Belongs to the MIP18 family.

Ontologies

Keywords
   Biological processChromosome partition
   Cellular componentCytoplasm
   Coding sequence diversityAlternative splicing
   LigandMetal-binding
Zinc
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processchromosome segregation

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentcytoplasm

Inferred from direct assay. Source: HPA

nucleus

Inferred from direct assay. Source: HPA

   Molecular_functionmetal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9H5X1-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9H5X1-2)

The sequence of this isoform differs from the canonical sequence as follows:
     97-160: GLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD → VGNLHF
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 160160MIP18 family protein FAM96A
PRO_0000212689

Sites

Metal binding891Zinc 1; shared with dimeric partner
Metal binding891Zinc 2; shared with dimeric partner
Metal binding1231Zinc 1; shared with dimeric partner
Metal binding1231Zinc 2; shared with dimeric partner
Metal binding1501Zinc 1; shared with dimeric partner
Metal binding1501Zinc 2; shared with dimeric partner
Metal binding1531Zinc 1; shared with dimeric partner
Metal binding1531Zinc 2; shared with dimeric partner

Natural variations

Alternative sequence97 – 16064GLCLR…VLEPD → VGNLHF in isoform 2.
VSP_042683

Secondary structure

......................... 160
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 1, 2001. Version 1.
Checksum: 8580E4E397067319

FASTA16018,355
        10         20         30         40         50         60 
MQRVSGLLSW TLSRVLWLSG LSEPGAARQP RIMEEKALEV YDLIRTIRDP EKPNTLEELE 

        70         80         90        100        110        120 
VVSESCVEVQ EINEEEYLVI IRFTPTVPHC SLATLIGLCL RVKLQRCLPF KHKLEIYISE 

       130        140        150        160 
GTHSTEEDIN KQINDKERVA AAMENPNLRE IVEQCVLEPD 

« Hide

Isoform 2 [UniParc].

Checksum: 09416E6149875BE1
Show »

FASTA10211,634

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Brain and Trachea.
[2]"Analysis of the DNA sequence and duplication history of human chromosome 15."
Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. expand/collapse author list , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[5]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[6]"N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB."
Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.
Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[7]"The mammalian DUF59 protein Fam96a forms two distinct types of domain-swapped dimer."
Chen K.E., Richards A.A., Ariffin J.K., Ross I.L., Sweet M.J., Kellie S., Kobe B., Martin J.L.
Acta Crystallogr. D 68:637-648(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 31-157, SUBUNIT, SUBCELLULAR LOCATION, ZINC-BINDING SITES, TISSUE SPECIFICITY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK026528 mRNA. Translation: BAB15496.1.
AK304202 mRNA. Translation: BAH14131.1.
AK312171 mRNA. Translation: BAG35105.1.
AC021541 Genomic DNA. No translation available.
CH471082 Genomic DNA. Translation: EAW77661.1.
CH471082 Genomic DNA. Translation: EAW77662.1.
BC008865 mRNA. Translation: AAH08865.1.
RefSeqNP_001014812.1. NM_001014812.2.
NP_115607.1. NM_032231.5.
UniGeneHs.439548.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2M5HNMR-A28-160[»]
3UX2X-ray1.80A31-157[»]
3UX3X-ray1.80A/B31-157[»]
ProteinModelPortalQ9H5X1.
SMRQ9H5X1. Positions 28-160.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid123939. 2 interactions.
IntActQ9H5X1. 1 interaction.
MINTMINT-1435495.
STRING9606.ENSP00000300030.

PTM databases

PhosphoSiteQ9H5X1.

Polymorphism databases

DMDM20455359.

Proteomic databases

PaxDbQ9H5X1.
PRIDEQ9H5X1.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000300030; ENSP00000300030; ENSG00000166797. [Q9H5X1-1]
ENST00000380290; ENSP00000369644; ENSG00000166797. [Q9H5X1-2]
ENST00000557835; ENSP00000454079; ENSG00000166797. [Q9H5X1-2]
GeneID84191.
KEGGhsa:84191.
UCSCuc002amt.1. human. [Q9H5X1-1]
uc002amu.1. human. [Q9H5X1-2]

Organism-specific databases

CTD84191.
GeneCardsGC15M064364.
H-InvDBHIX0012334.
HGNCHGNC:26235. FAM96A.
HPAHPA040459.
neXtProtNX_Q9H5X1.
PharmGKBPA142671829.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5133.
HOGENOMHOG000157065.
HOVERGENHBG029509.
InParanoidQ9H5X1.
OMAQVKLQRC.
OrthoDBEOG7034J5.
PhylomeDBQ9H5X1.
TreeFamTF323934.

Gene expression databases

ArrayExpressQ9H5X1.
BgeeQ9H5X1.
CleanExHS_FAM96A.
GenevestigatorQ9H5X1.

Family and domain databases

InterProIPR002744. DUF59.
[Graphical view]
PfamPF01883. DUF59. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSFAM96A. human.
GenomeRNAi84191.
NextBio73586.
PROQ9H5X1.

Entry information

Entry nameFA96A_HUMAN
AccessionPrimary (citable) accession number: Q9H5X1
Secondary accession number(s): A6NKS1, B2R5F8, B7Z8Z5
Entry history
Integrated into UniProtKB/Swiss-Prot: May 2, 2002
Last sequence update: March 1, 2001
Last modified: April 16, 2014
This is version 91 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

Human chromosome 15

Human chromosome 15: entries, gene names and cross-references to MIM