Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MIP18 family protein FAM96A

Gene

FAM96A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May play a role in chromosome segregation through establishment of sister chromatid cohesion.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi89Zinc 1; shared with dimeric partner1
Metal bindingi89Zinc 2; shared with dimeric partner1
Metal bindingi123Zinc 1; shared with dimeric partner1
Metal bindingi123Zinc 2; shared with dimeric partner1
Metal bindingi150Zinc 1; shared with dimeric partner1
Metal bindingi150Zinc 2; shared with dimeric partner1
Metal bindingi153Zinc 1; shared with dimeric partner1
Metal bindingi153Zinc 2; shared with dimeric partner1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Chromosome partition

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000166797-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
MIP18 family protein FAM96A
Gene namesi
Name:FAM96A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:26235. FAM96A.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi84191.
OpenTargetsiENSG00000166797.
PharmGKBiPA142671829.

Polymorphism and mutation databases

BioMutaiFAM96A.
DMDMi20455359.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002126891 – 160MIP18 family protein FAM96AAdd BLAST160

Proteomic databases

EPDiQ9H5X1.
MaxQBiQ9H5X1.
PaxDbiQ9H5X1.
PeptideAtlasiQ9H5X1.
PRIDEiQ9H5X1.

PTM databases

iPTMnetiQ9H5X1.
PhosphoSitePlusiQ9H5X1.

Expressioni

Tissue specificityi

Substantially enriched in macrophages.1 Publication

Gene expression databases

BgeeiENSG00000166797.
CleanExiHS_FAM96A.
ExpressionAtlasiQ9H5X1. baseline and differential.
GenevisibleiQ9H5X1. HS.

Organism-specific databases

HPAiHPA040459.
HPA063729.

Interactioni

Subunit structurei

Monomer and homodimer. Interacts with CIAO1.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
CIAO1O7607110EBI-752069,EBI-725145

Protein-protein interaction databases

BioGridi123939. 11 interactors.
IntActiQ9H5X1. 2 interactors.
MINTiMINT-1435495.
STRINGi9606.ENSP00000300030.

Structurei

Secondary structure

1160
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi31 – 44Combined sources14
Beta strandi50 – 55Combined sources6
Turni56 – 60Combined sources5
Helixi64 – 66Combined sources3
Beta strandi67 – 73Combined sources7
Beta strandi76 – 81Combined sources6
Beta strandi86 – 88Combined sources3
Helixi92 – 107Combined sources16
Beta strandi112 – 120Combined sources9
Beta strandi122 – 124Combined sources3
Helixi129 – 134Combined sources6
Helixi136 – 144Combined sources9
Helixi146 – 156Combined sources11

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2M5HNMR-A28-160[»]
3UX2X-ray1.80A31-157[»]
3UX3X-ray1.80A/B31-157[»]
ProteinModelPortaliQ9H5X1.
SMRiQ9H5X1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the MIP18 family.Curated

Phylogenomic databases

eggNOGiKOG3381. Eukaryota.
COG5133. LUCA.
GeneTreeiENSGT00390000017697.
HOGENOMiHOG000082425.
HOVERGENiHBG029509.
InParanoidiQ9H5X1.
OMAiLCLRIKL.
OrthoDBiEOG091G0OZO.
PhylomeDBiQ9H5X1.
TreeFamiTF323934.

Family and domain databases

InterProiIPR002744. DUF59.
[Graphical view]
PfamiPF01883. DUF59. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H5X1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQRVSGLLSW TLSRVLWLSG LSEPGAARQP RIMEEKALEV YDLIRTIRDP
60 70 80 90 100
EKPNTLEELE VVSESCVEVQ EINEEEYLVI IRFTPTVPHC SLATLIGLCL
110 120 130 140 150
RVKLQRCLPF KHKLEIYISE GTHSTEEDIN KQINDKERVA AAMENPNLRE
160
IVEQCVLEPD
Length:160
Mass (Da):18,355
Last modified:March 1, 2001 - v1
Checksum:i8580E4E397067319
GO
Isoform 2 (identifier: Q9H5X1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     97-160: GLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD → VGNLHF

Note: No experimental confirmation available.
Show »
Length:102
Mass (Da):11,634
Checksum:i09416E6149875BE1
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04268397 – 160GLCLR…VLEPD → VGNLHF in isoform 2. 1 PublicationAdd BLAST64

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK026528 mRNA. Translation: BAB15496.1.
AK304202 mRNA. Translation: BAH14131.1.
AK312171 mRNA. Translation: BAG35105.1.
AC021541 Genomic DNA. No translation available.
CH471082 Genomic DNA. Translation: EAW77661.1.
CH471082 Genomic DNA. Translation: EAW77662.1.
BC008865 mRNA. Translation: AAH08865.1.
CCDSiCCDS10189.1. [Q9H5X1-1]
CCDS45278.1. [Q9H5X1-2]
RefSeqiNP_001014812.1. NM_001014812.2. [Q9H5X1-2]
NP_001276037.1. NM_001289108.1. [Q9H5X1-2]
NP_115607.1. NM_032231.5. [Q9H5X1-1]
UniGeneiHs.439548.

Genome annotation databases

EnsembliENST00000300030; ENSP00000300030; ENSG00000166797. [Q9H5X1-1]
ENST00000380290; ENSP00000369644; ENSG00000166797. [Q9H5X1-2]
ENST00000557835; ENSP00000454079; ENSG00000166797. [Q9H5X1-2]
GeneIDi84191.
KEGGihsa:84191.
UCSCiuc002amt.3. human. [Q9H5X1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK026528 mRNA. Translation: BAB15496.1.
AK304202 mRNA. Translation: BAH14131.1.
AK312171 mRNA. Translation: BAG35105.1.
AC021541 Genomic DNA. No translation available.
CH471082 Genomic DNA. Translation: EAW77661.1.
CH471082 Genomic DNA. Translation: EAW77662.1.
BC008865 mRNA. Translation: AAH08865.1.
CCDSiCCDS10189.1. [Q9H5X1-1]
CCDS45278.1. [Q9H5X1-2]
RefSeqiNP_001014812.1. NM_001014812.2. [Q9H5X1-2]
NP_001276037.1. NM_001289108.1. [Q9H5X1-2]
NP_115607.1. NM_032231.5. [Q9H5X1-1]
UniGeneiHs.439548.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2M5HNMR-A28-160[»]
3UX2X-ray1.80A31-157[»]
3UX3X-ray1.80A/B31-157[»]
ProteinModelPortaliQ9H5X1.
SMRiQ9H5X1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123939. 11 interactors.
IntActiQ9H5X1. 2 interactors.
MINTiMINT-1435495.
STRINGi9606.ENSP00000300030.

PTM databases

iPTMnetiQ9H5X1.
PhosphoSitePlusiQ9H5X1.

Polymorphism and mutation databases

BioMutaiFAM96A.
DMDMi20455359.

Proteomic databases

EPDiQ9H5X1.
MaxQBiQ9H5X1.
PaxDbiQ9H5X1.
PeptideAtlasiQ9H5X1.
PRIDEiQ9H5X1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000300030; ENSP00000300030; ENSG00000166797. [Q9H5X1-1]
ENST00000380290; ENSP00000369644; ENSG00000166797. [Q9H5X1-2]
ENST00000557835; ENSP00000454079; ENSG00000166797. [Q9H5X1-2]
GeneIDi84191.
KEGGihsa:84191.
UCSCiuc002amt.3. human. [Q9H5X1-1]

Organism-specific databases

CTDi84191.
DisGeNETi84191.
GeneCardsiFAM96A.
H-InvDBHIX0012334.
HGNCiHGNC:26235. FAM96A.
HPAiHPA040459.
HPA063729.
neXtProtiNX_Q9H5X1.
OpenTargetsiENSG00000166797.
PharmGKBiPA142671829.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3381. Eukaryota.
COG5133. LUCA.
GeneTreeiENSGT00390000017697.
HOGENOMiHOG000082425.
HOVERGENiHBG029509.
InParanoidiQ9H5X1.
OMAiLCLRIKL.
OrthoDBiEOG091G0OZO.
PhylomeDBiQ9H5X1.
TreeFamiTF323934.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000166797-MONOMER.

Miscellaneous databases

ChiTaRSiFAM96A. human.
GenomeRNAii84191.
PROiQ9H5X1.

Gene expression databases

BgeeiENSG00000166797.
CleanExiHS_FAM96A.
ExpressionAtlasiQ9H5X1. baseline and differential.
GenevisibleiQ9H5X1. HS.

Family and domain databases

InterProiIPR002744. DUF59.
[Graphical view]
PfamiPF01883. DUF59. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFA96A_HUMAN
AccessioniPrimary (citable) accession number: Q9H5X1
Secondary accession number(s): A6NKS1, B2R5F8, B7Z8Z5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 2, 2002
Last sequence update: March 1, 2001
Last modified: November 30, 2016
This is version 117 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.