Q9H4W6 (COE3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 94.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Transcription factor COE3 Alternative name(s): Early B-cell factor 3 Short name=EBF-3 Olf-1/EBF-like 2 Short name=O/E-2 Short name=OE-2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 596 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transcriptional activator which recognizes variations of the palindromic sequence 5'-ATTCCCNNGGGAATT-3' By similarity. |
| Subunit structure | Forms either a homodimer or a heterodimer with a related family member By similarity. |
| Subcellular location | Nucleus Potential. |
| Tissue specificity | Expressed in brain. Ref.4 |
| Sequence similarities | Belongs to the COE family. Contains 1 IPT/TIG domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Zinc-finger |
| Ligand | DNA-binding Metal-binding Zinc |
| Molecular function | Activator Developmental protein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | multicellular organismal development Inferred from electronic annotation. Source: UniProtKB-KW regulation of transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | nucleus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | DNA binding Inferred from electronic annotation. Source: UniProtKB-KW metal ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| MEN1 | O00255 | 1 | EBI-2111898,EBI-592789 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Long (identifier: Q9H4W6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Short (identifier: Q9H4W6-2) The sequence of this isoform differs from the canonical sequence as follows: 252-260: Missing. 521-558: IVPSSPTMAASSVTLPSNCSSTHGIFSFSPANVISAVK → MK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 596 | 596 | Transcription factor COE3 | PRO_0000107832 | |||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||
| Domain | 263 – 346 | 84 | IPT/TIG | ||||||||||||||||||||||||
| Zinc finger | 151 – 170 | 20 | C5-type Potential | ||||||||||||||||||||||||
| Region | 63 – 66 | 4 | Interaction with DNA By similarity | ||||||||||||||||||||||||
| Region | 197 – 204 | 8 | Interaction with DNA By similarity | ||||||||||||||||||||||||
| Region | 236 – 239 | 4 | Interaction with DNA By similarity | ||||||||||||||||||||||||
| Compositional bias | 464 – 555 | 92 | Pro/Ser/Thr-rich | ||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||
| Site | 163 | 1 | Interaction with DNA By similarity | ||||||||||||||||||||||||
| Site | 172 | 1 | Interaction with DNA By similarity | ||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||
| Alternative sequence | 252 – 260 | 9 | Missing in isoform Short. | VSP_001113 | |||||||||||||||||||||||
| Alternative sequence | 521 – 558 | 38 | IVPSS…ISAVK → MK in isoform Short. | VSP_001114 | |||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||
| Beta strand | 267 – 270 | 4 | |||||||||||||||||||||||||
| Beta strand | 280 – 284 | 5 | |||||||||||||||||||||||||
| Beta strand | 293 – 295 | 3 | |||||||||||||||||||||||||
| Beta strand | 303 – 307 | 5 | |||||||||||||||||||||||||
| Beta strand | 310 – 314 | 5 | |||||||||||||||||||||||||
| Beta strand | 327 – 330 | 4 | |||||||||||||||||||||||||
| Beta strand | 333 – 335 | 3 | |||||||||||||||||||||||||
| Helix | 358 – 363 | 6 | |||||||||||||||||||||||||
| Helix | 376 – 390 | 15 | |||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed: 15164054] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORMS LONG AND SHORT). |
| [2] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT). |
| [4] | "Integrated genomic and epigenomic analyses pinpoint biallelic gene inactivation in tumors." Zardo G., Tiirikainen M.I., Hong C., Misra A., Feuerstein B.G., Volik S., Collins C.C., Lamborn K.R., Bollen A., Pinkel D., Albertson D.G., Costello J.F. Nat. Genet. 32:453-458(2002) [PubMed: 12355068] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [5] | "Structural determination of functional domains in early B-cell factor (EBF) family of transcription factors reveals similarities to Rel DNA-binding proteins and a novel dimerization motif." Siponen M.I., Wisniewska M., Lehtio L., Johansson I., Svensson L., Raszewski G., Nilsson L., Sigvardsson M., Berglund H. J. Biol. Chem. 285:25875-25879(2010) [PubMed: 20592035] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.92 ANGSTROMS) OF 261-415. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AL354950 Genomic DNA. Translation: CAI12792.1. AL354950 Genomic DNA. Translation: CAI12793.1. CH471066 Genomic DNA. Translation: EAW49160.1. BC126130 mRNA. Translation: AAI26131.1. BC130479 mRNA. Translation: AAI30480.1. | ||||||||||||||||||
| IPI | IPI00024242. IPI00220430. | ||||||||||||||||||
| RefSeq | NP_001005463.1. NM_001005463.2. | ||||||||||||||||||
| UniGene | Hs.591374. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q9H4W6. | ||||||||||||||||||
| SMR | Q9H4W6. Positions 35-414. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| STRING | Q9H4W6. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 13959320. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | Q9H4W6. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000355311; ENSP00000347463; ENSG00000108001. | ||||||||||||||||||
| GeneID | 253738. | ||||||||||||||||||
| KEGG | hsa:253738. | ||||||||||||||||||
| UCSC | uc001lki.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 253738. | ||||||||||||||||||
| GeneCards | GC10M131633. | ||||||||||||||||||
| HGNC | HGNC:19087. EBF3. | ||||||||||||||||||
| MIM | 607407. gene. | ||||||||||||||||||
| neXtProt | NX_Q9H4W6. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| GeneTree | ENSGT00390000014051. | ||||||||||||||||||
| HOGENOM | HBG444229. | ||||||||||||||||||
| HOVERGEN | HBG005108. | ||||||||||||||||||
| InParanoid | Q9H4W6. | ||||||||||||||||||
| OMA | ANSPYGM. | ||||||||||||||||||
| OrthoDB | EOG4TXBRK. | ||||||||||||||||||
| PhylomeDB | Q9H4W6. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q9H4W6. | ||||||||||||||||||
| Bgee | Q9H4W6. | ||||||||||||||||||
| CleanEx | HS_EBF3. | ||||||||||||||||||
| Genevestigator | Q9H4W6. | ||||||||||||||||||
| GermOnline | ENSG00000108001. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR011598. HLH_DNA-bd. IPR013783. Ig-like_fold. IPR014756. Ig_E-set. IPR002909. IPT_TIG_rcpt. IPR003523. Transcription_factor_COE. IPR018350. Transcription_factor_COE_CS. [Graphical view] | ||||||||||||||||||
| Gene3D | G3DSA:2.60.40.10. Ig-like_fold. 1 hit. | ||||||||||||||||||
| KO | K09103. | ||||||||||||||||||
| PANTHER | PTHR10747. TF_COE. 1 hit. | ||||||||||||||||||
| Pfam | PF01833. TIG. 1 hit. [Graphical view] | ||||||||||||||||||
| SMART | SM00353. HLH. 1 hit. SM00429. IPT. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF81296. Ig_E-set. 1 hit. | ||||||||||||||||||
| PROSITE | PS01345. COE. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | COE3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H4W6 Secondary accession number(s): A0AUY1, Q5T6H9, Q9H4W5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with