Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcription factor COE3

Gene

EBF3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Transcriptional activator which recognizes variations of the palindromic sequence 5'-ATTCCCNNGGGAATT-3'.By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri151 – 17020C5-typeSequence analysisAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Activator, Developmental protein

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription factor COE3
Alternative name(s):
Early B-cell factor 3
Short name:
EBF-3
Olf-1/EBF-like 2
Short name:
O/E-2
Short name:
OE-2
Gene namesi
Name:EBF3
Synonyms:COE3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:19087. EBF3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134972607.

Polymorphism and mutation databases

BioMutaiEBF3.
DMDMi13959320.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 596596Transcription factor COE3PRO_0000107832Add
BLAST

Proteomic databases

EPDiQ9H4W6.
MaxQBiQ9H4W6.
PeptideAtlasiQ9H4W6.
PRIDEiQ9H4W6.

PTM databases

iPTMnetiQ9H4W6.
PhosphoSiteiQ9H4W6.

Expressioni

Tissue specificityi

Expressed in brain.1 Publication

Gene expression databases

BgeeiQ9H4W6.
CleanExiHS_EBF3.
ExpressionAtlasiQ9H4W6. baseline and differential.
GenevisibleiQ9H4W6. HS.

Interactioni

Subunit structurei

Forms either a homodimer or a heterodimer with a related family member.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei163 – 1631Interaction with DNABy similarity
Sitei172 – 1721Interaction with DNABy similarity

Protein-protein interaction databases

BioGridi128985. 7 interactions.
IntActiQ9H4W6. 2 interactions.

Structurei

Secondary structure

1
596
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi264 – 27411Combined sources
Beta strandi280 – 2878Combined sources
Beta strandi293 – 2964Combined sources
Beta strandi299 – 3013Combined sources
Beta strandi303 – 3075Combined sources
Beta strandi310 – 3145Combined sources
Beta strandi322 – 3309Combined sources
Beta strandi333 – 3353Combined sources
Beta strandi337 – 3393Combined sources
Beta strandi341 – 3466Combined sources
Helixi353 – 36311Combined sources
Helixi376 – 39116Combined sources
Helixi396 – 41217Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3MUJX-ray1.92A/B261-395[»]
3N50X-ray3.10A/B/C/D/E/F261-415[»]
ProteinModelPortaliQ9H4W6.
SMRiQ9H4W6. Positions 35-414.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9H4W6.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini263 – 34684IPT/TIGAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni63 – 664Interaction with DNABy similarity
Regioni197 – 2048Interaction with DNABy similarity
Regioni236 – 2394Interaction with DNABy similarity

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi464 – 55592Pro/Ser/Thr-richAdd
BLAST

Sequence similaritiesi

Belongs to the COE family.Curated
Contains 1 IPT/TIG domain.Curated

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri151 – 17020C5-typeSequence analysisAdd
BLAST

Keywords - Domaini

Zinc-finger

Phylogenomic databases

GeneTreeiENSGT00390000014051.
HOGENOMiHOG000092311.
HOVERGENiHBG005108.
InParanoidiQ9H4W6.
KOiK09103.
OMAiASHGGMM.
OrthoDBiEOG7J446V.
PhylomeDBiQ9H4W6.
TreeFamiTF313391.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR032200. COE_DBD.
IPR032201. COE_HLH.
IPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR003523. Transcription_factor_COE.
IPR018350. Transcription_factor_COE_CS.
[Graphical view]
PANTHERiPTHR10747. PTHR10747. 1 hit.
PfamiPF16422. COE1_DBD. 1 hit.
PF16423. COE1_HLH. 1 hit.
PF01833. TIG. 1 hit.
[Graphical view]
SMARTiSM00429. IPT. 1 hit.
[Graphical view]
SUPFAMiSSF81296. SSF81296. 1 hit.
PROSITEiPS01345. COE. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Long (identifier: Q9H4W6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFGIQENIPR GGTTMKEEPL GSGMNPVRSW MHTAGVVDAN TAAQSGVGLA
60 70 80 90 100
RAHFEKQPPS NLRKSNFFHF VLALYDRQGQ PVEIERTAFV DFVEKEKEPN
110 120 130 140 150
NEKTNNGIHY KLQLLYSNGV RTEQDLYVRL IDSMTKQAIV YEGQDKNPEM
160 170 180 190 200
CRVLLTHEIM CSRCCDKKSC GNRNETPSDP VIIDRFFLKF FLKCNQNCLK
210 220 230 240 250
NAGNPRDMRR FQVVVSTTVN VDGHVLAVSD NMFVHNNSKH GRRARRLDPS
260 270 280 290 300
EGTAPSYLEN ATPCIKAISP SEGWTTGGAT VIIIGDNFFD GLQVVFGTML
310 320 330 340 350
VWSELITPHA IRVQTPPRHI PGVVEVTLSY KSKQFCKGAP GRFVYTALNE
360 370 380 390 400
PTIDYGFQRL QKVIPRHPGD PERLPKEVLL KRAADLVEAL YGMPHNNQEI
410 420 430 440 450
ILKRAADIAE ALYSVPRNHN QIPTLGNNPA HTGMMGVNSF SSQLAVNVSE
460 470 480 490 500
TSQANDQVGY SRNTSSVSPR GYVPSSTPQQ SNYNTVSTSM NGYGSGAMAS
510 520 530 540 550
LGVPGSPGFL NGSSANSPYG IVPSSPTMAA SSVTLPSNCS STHGIFSFSP
560 570 580 590
ANVISAVKQK SAFAPVVRPQ ASPPPSCTSA NGNGLQAMSG LVVPPM
Length:596
Mass (Da):64,864
Last modified:May 4, 2001 - v2
Checksum:iEE5C9D10CD3DED02
GO
Isoform Short (identifier: Q9H4W6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     252-260: Missing.
     521-558: IVPSSPTMAASSVTLPSNCSSTHGIFSFSPANVISAVK → MK

Show »
Length:551
Mass (Da):60,415
Checksum:i0813B855111FAB12
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei252 – 2609Missing in isoform Short. 1 PublicationVSP_001113
Alternative sequencei521 – 55838IVPSS…ISAVK → MK in isoform Short. 1 PublicationVSP_001114Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL354950 Genomic DNA. Translation: CAI12792.1.
AL354950 Genomic DNA. Translation: CAI12793.1.
CH471066 Genomic DNA. Translation: EAW49160.1.
BC126130 mRNA. Translation: AAI26131.1.
BC130479 mRNA. Translation: AAI30480.1.
CCDSiCCDS31314.1. [Q9H4W6-2]
RefSeqiNP_001005463.1. NM_001005463.2. [Q9H4W6-2]
XP_005252725.1. XM_005252668.2. [Q9H4W6-1]
UniGeneiHs.591374.

Genome annotation databases

EnsembliENST00000355311; ENSP00000347463; ENSG00000108001. [Q9H4W6-1]
ENST00000368648; ENSP00000357637; ENSG00000108001. [Q9H4W6-2]
GeneIDi253738.
KEGGihsa:253738.
UCSCiuc001lki.3. human. [Q9H4W6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL354950 Genomic DNA. Translation: CAI12792.1.
AL354950 Genomic DNA. Translation: CAI12793.1.
CH471066 Genomic DNA. Translation: EAW49160.1.
BC126130 mRNA. Translation: AAI26131.1.
BC130479 mRNA. Translation: AAI30480.1.
CCDSiCCDS31314.1. [Q9H4W6-2]
RefSeqiNP_001005463.1. NM_001005463.2. [Q9H4W6-2]
XP_005252725.1. XM_005252668.2. [Q9H4W6-1]
UniGeneiHs.591374.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3MUJX-ray1.92A/B261-395[»]
3N50X-ray3.10A/B/C/D/E/F261-415[»]
ProteinModelPortaliQ9H4W6.
SMRiQ9H4W6. Positions 35-414.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128985. 7 interactions.
IntActiQ9H4W6. 2 interactions.

PTM databases

iPTMnetiQ9H4W6.
PhosphoSiteiQ9H4W6.

Polymorphism and mutation databases

BioMutaiEBF3.
DMDMi13959320.

Proteomic databases

EPDiQ9H4W6.
MaxQBiQ9H4W6.
PeptideAtlasiQ9H4W6.
PRIDEiQ9H4W6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000355311; ENSP00000347463; ENSG00000108001. [Q9H4W6-1]
ENST00000368648; ENSP00000357637; ENSG00000108001. [Q9H4W6-2]
GeneIDi253738.
KEGGihsa:253738.
UCSCiuc001lki.3. human. [Q9H4W6-1]

Organism-specific databases

CTDi253738.
GeneCardsiEBF3.
HGNCiHGNC:19087. EBF3.
MIMi607407. gene.
neXtProtiNX_Q9H4W6.
PharmGKBiPA134972607.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000014051.
HOGENOMiHOG000092311.
HOVERGENiHBG005108.
InParanoidiQ9H4W6.
KOiK09103.
OMAiASHGGMM.
OrthoDBiEOG7J446V.
PhylomeDBiQ9H4W6.
TreeFamiTF313391.

Miscellaneous databases

ChiTaRSiEBF3. human.
EvolutionaryTraceiQ9H4W6.
GenomeRNAii253738.
PROiQ9H4W6.
SOURCEiSearch...

Gene expression databases

BgeeiQ9H4W6.
CleanExiHS_EBF3.
ExpressionAtlasiQ9H4W6. baseline and differential.
GenevisibleiQ9H4W6. HS.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR032200. COE_DBD.
IPR032201. COE_HLH.
IPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR003523. Transcription_factor_COE.
IPR018350. Transcription_factor_COE_CS.
[Graphical view]
PANTHERiPTHR10747. PTHR10747. 1 hit.
PfamiPF16422. COE1_DBD. 1 hit.
PF16423. COE1_HLH. 1 hit.
PF01833. TIG. 1 hit.
[Graphical view]
SMARTiSM00429. IPT. 1 hit.
[Graphical view]
SUPFAMiSSF81296. SSF81296. 1 hit.
PROSITEiPS01345. COE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORMS LONG AND SHORT).
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT).
  4. "Integrated genomic and epigenomic analyses pinpoint biallelic gene inactivation in tumors."
    Zardo G., Tiirikainen M.I., Hong C., Misra A., Feuerstein B.G., Volik S., Collins C.C., Lamborn K.R., Bollen A., Pinkel D., Albertson D.G., Costello J.F.
    Nat. Genet. 32:453-458(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  5. "Structural determination of functional domains in early B-cell factor (EBF) family of transcription factors reveals similarities to Rel DNA-binding proteins and a novel dimerization motif."
    Siponen M.I., Wisniewska M., Lehtio L., Johansson I., Svensson L., Raszewski G., Nilsson L., Sigvardsson M., Berglund H.
    J. Biol. Chem. 285:25875-25879(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.92 ANGSTROMS) OF 261-415.

Entry informationi

Entry nameiCOE3_HUMAN
AccessioniPrimary (citable) accession number: Q9H4W6
Secondary accession number(s): A0AUY1, Q5T6H9, Q9H4W5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 4, 2001
Last sequence update: May 4, 2001
Last modified: July 6, 2016
This is version 131 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.