Q9H4A3 (WNK1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 131.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Serine/threonine-protein kinase WNK1 EC=2.7.11.1 Alternative name(s): Erythrocyte 65 kDa protein Short name=p65 Kinase deficient protein Protein kinase lysine-deficient 1 Protein kinase with no lysine 1 Short name=hWNK1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 2382 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Serine/threonine kinase which plays an important role in the regulation of electrolyte homeostasis, cell signaling, survival, and proliferation. Acts as an activator and inhibitor of sodium-coupled chloride cotransporters and potassium-coupled chloride cotransporters respectively. Activates SCNN1A, SCNN1B, SCNN1D and SGK1. Controls sodium and chloride ion transport by inhibiting the activity of WNK4, by either phosphorylating the kinase or via an interaction between WNK4 and the autoinhibitory domain of WNK1. WNK4 regulates the activity of the thiazide-sensitive Na-Cl cotransporter, SLC12A3, by phosphorylation. WNK1 may also play a role in actin cytoskeletal reorganization. Phosphorylates NEDD4L By similarity. Ref.4 Ref.10 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Cofactor | Magnesium. Ref.4 |
| Enzyme regulation | By hypertonicity. Activation requires autophosphorylation of Ser-382. Phosphorylation of Ser-378 also promotes increased activity By similarity. UniProtKB Q9JIH7 |
| Subunit structure | Interacts with SYT2 By similarity. Interacts with WNK3 and WNK4 By similarity. |
| Subcellular location | |
| Tissue specificity | Widely expressed, with highest levels observed in the testis, heart, kidney and skeletal muscle. Isoform 3 is kidney-specific. Ref.1 Ref.4 Ref.8 |
| Post-translational modification | O-glycosylated. Ref.7 |
| Involvement in disease | Pseudohypoaldosteronism 2C (PHA2C) [MIM:614492]: An autosomal dominant disorder characterized by severe hypertension, hyperkalemia, hyperchloremia, mild hyperchloremic metabolic acidosis in some cases, and correction of physiologic abnormalities by thiazide diuretics. Hereditary sensory and autonomic neuropathy 2A (HSAN2A) [MIM:201300]: A form of hereditary sensory and autonomic neuropathy, a genetically and clinically heterogeneous group of disorders characterized by degeneration of dorsal root and autonomic ganglion cells, and by sensory and/or autonomic abnormalities. HSAN2A is an autosomal recessive disorder characterized by impairment of pain, temperature and touch sensation, onset of symptoms in infancy or early childhood, occurrence of distal extremity pathologies (paronychia, whitlows, ulcers, and Charcot joints), frequent amputations, sensory loss that affects all modalities of sensation (lower and upper limbs and perhaps the trunk as well), absence or diminution of tendon reflexes (usually in all limbs), minimal autonomic dysfunction, absence of sensory nerve action potentials, and virtual absence of myelinated fibers with decreased numbers of unmyelinated fibers in sural nerves. |
| Sequence similarities | Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. WNK subfamily. Contains 1 protein kinase domain. |
| Caution | Ref.7 describes a peptide sequence containing a GlcNAc glycosylated Ser in position 164 while it is an Arg residue according to others. Cys-250 is present instead of the conserved Lys which is expected to be an active site residue. Lys-233 appears to fulfill the required catalytic function. UniProtKB Q9JIH7 HSN2 was originally thought to be an intronless gene lying within a WNK1 gene intron. It has been shown to be a nervous system-specific exon of WNK1 included in isoform 4 and isoform 5 (Ref.15). It is uncertain whether Met-1 or Met-214 is the initiator in isoform 4 and isoform 5. |
| Sequence caution | The sequence AAF31483.1 differs from that shown. Reason: Contaminating sequence. Sequence of unknown origin in the C-terminal part. The sequence AAI30468.1 differs from that shown. Reason: Probable cloning artifact. The sequence AAI30470.1 differs from that shown. Reason: Probable cloning artifact. The sequence DAA04494.1 differs from that shown. Reason: Erroneous gene model prediction. Includes 3' and 3' intronic sequences. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| PPP1CA | P62136 | 2 | EBI-457907,EBI-357253 | |
| Syt2 | P29101 | 2 | EBI-457907,EBI-458017 | From a different organism. |
Alternative products
| This entry describes 5 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] | ||||||
| Isoform 1 Ref.1 (identifier: Q9H4A3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Produced by alternative promoter usage. | ||||||
| Isoform 2 Ref.5 (identifier: Q9H4A3-2) The sequence of this isoform differs from the canonical sequence as follows: 740-740: Missing. 792-1037: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 Ref.8 (identifier: Q9H4A3-4) The sequence of this isoform differs from the canonical sequence as follows: 1-407: Missing. 408-437: FGMCMLEMATSEYPYSECQNAAQIYRRVTS → MDIKKKDFCSVFVIINSHCCCCPQKDCINE | ||||||
| Note: Kinase-defective isoform. Produced by alternative promoter usage and alternative splicing. | ||||||
| Isoform 4 Ref.8 (identifier: Q9H4A3-5) Also known as: Brain and spinal cord variant; The sequence of this isoform differs from the canonical sequence as follows: 714-1037: AQGQSQGQPS...TTSSQQAVLE → PRRGRSMSVC...VLPQVSAGKQ | ||||||
| Note: Contains the nervous system-specific exon HSN2. Produced by alternative splicing. | ||||||
| Isoform 5 (identifier: Q9H4A3-6) Also known as: Dorsal root ganglia and sciatic nerve variant; DRG and sciatic nerve variant; The sequence of this isoform differs from the canonical sequence as follows: 713-713: V → VPQSMAHPCG...SSGGSALHPQ 792-944: Missing. | ||||||
| Note: Contains the nervous system-specific exon HSN2. Produced by alternative splicing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 2382 | 2382 | Serine/threonine-protein kinase WNK1 | PRO_0000086819 | |||||
Regions | |||||||||
| Domain | 221 – 479 | 259 | Protein kinase | ||||||
| Nucleotide binding | 227 – 235 | 9 | ATP By similarity UniProtKB Q8TDX7 | ||||||
Sites | |||||||||
| Active site | 349 | 1 | Proton acceptor By similarity UniProtKB Q8TDX7 | ||||||
| Binding site | 233 | 1 | ATP By similarity UniProtKB Q9JIH7 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 19 | 1 | Phosphoserine Ref.17 Ref.19 | ||||||
| Modified residue | 167 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 378 | 1 | Phosphoserine; by autocatalysis By similarity UniProtKB Q9JIH7 | ||||||
| Modified residue | 382 | 1 | Phosphoserine; by autocatalysis By similarity UniProtKB Q9JIH7 | ||||||
| Modified residue | 1261 | 1 | Phosphoserine Ref.14 Ref.17 Ref.19 | ||||||
| Modified residue | 1978 | 1 | Phosphoserine Ref.18 Ref.19 | ||||||
| Modified residue | 2002 | 1 | Phosphoserine Ref.13 | ||||||
| Modified residue | 2011 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 2012 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 2027 | 1 | Phosphoserine Ref.17 Ref.21 | ||||||
| Modified residue | 2029 | 1 | Phosphoserine Ref.17 Ref.21 | ||||||
| Modified residue | 2032 | 1 | Phosphoserine Ref.13 Ref.17 Ref.19 Ref.21 | ||||||
| Modified residue | 2121 | 1 | Phosphoserine Ref.19 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 407 | 407 | Missing in isoform 3. Ref.8 | VSP_050634 | |||||
| Alternative sequence | 408 – 437 | 30 | FGMCM…RRVTS → MDIKKKDFCSVFVIINSHCC CCPQKDCINE in isoform 3. Ref.8 | VSP_050637 | |||||
| Alternative sequence | 713 | 1 | V → VPQSMAHPCGGTPTYPESQI FFPTIHERPVSFSPPPTCPP KVAISQRRKSTSFLEAQTHH FQPLLRTVGQSLLPPGGSPT NWTPEAVVMLGTTASRVTGE SCEIQVHPMFEPSQVYSDYR PGLVLPEEAHYFIPQEAVYV AGVHYQARVAEQYEGIPYNS SVLSSPMKQIPEQKPVQGGP TSSSVFEFPSGQAFLVGHLQ NLRLDSGLGPGSPLSSISAP ISTDATRLKFHPVFVPHSAP AVLTHNNESRSNCVFEFHVH TPSSSSGEGGGILPQRVYRN RQVAVDLNQEELPPQSVGLH GYLQPVTEEKHNYHAPELTV SVVEPIGQNWPIGSPEYSSD SSQITSSDPSDFQSPPPTGG AAAPFGSDVSMPFIHLPQTV LQESPLFFCFPQGTTSQQVL TASFSSGGSALHPQ in isoform 5. | VSP_040267 | |||||
| Alternative sequence | 714 – 1037 | 324 | AQGQS…QAVLE → PRRGRSMSVCVPIFLLLPLC PASLPVLFHPTASTVCTSFS FPPPDCPEETFAEKLSKALE SVLPMHSASQRKHRRSSLPS LFVSTPQSMAHPCGGTPTYP ESQIFFPTIHERPVSFSPPP TCPPKVAISQRRKSTSFLEA QTHHFQPLLRTVGQSLLPPG GSPTNWTPEAVVMLGTTASR VTGESCEIQVHPMFEPSQVY SDYRPGLVLPEEAHYFIPQE AVYVAGVHYQARVAEQYEGI PYNSSVLSSPMKQIPEQKPV QGGPTSSSVFEFPSGQAFLV GHLQNLRLDSGLGPGSPLSS ISAPISTDATRLKFHPVFVP HSAPAVLTHNNESRSNCVFE FHVHTPSSSSGEGGGILPQR VYRNRQVAVDLNQEELPPQS VGLHGYLQPVTEEKHNYHAP ELTVSVVEPIGQNWPIGSPE YSSDSSQITSSDPSDFQSPP PTGGAAAPFGSDVSMPFIHL PQTVLQESPLFFCFPQGTTS QQVLTASFSSGGSALHPQAQ GQSQGQPSSSSLTGVSSSQP IQHPQQQQGIQQTAPPQQTV QYSLSQTSTSSEATTAQPVS QPQAPQVLPQVSAGKQ in isoform 4. | VSP_040268 | |||||
| Alternative sequence | 740 | 1 | Missing in isoform 2. | VSP_040269 | |||||
| Alternative sequence | 792 – 1037 | 246 | Missing in isoform 2. Ref.5 | VSP_050638 | |||||
| Alternative sequence | 792 – 944 | 153 | Missing in isoform 5. | VSP_040270 | |||||
| Natural variant | 141 | 1 | A → T. Ref.23 Corresponds to variant rs11554421 [ dbSNP | Ensembl ]. | VAR_041309 | |||||
| Natural variant | 149 | 1 | A → V. Ref.23 Corresponds to variant rs34880640 [ dbSNP | Ensembl ]. | VAR_041310 | |||||
| Natural variant | 419 | 1 | E → Q in a breast pleomorphic lobular carcinoma sample; somatic mutation. Ref.23 | VAR_041311 | |||||
| Natural variant | 509 | 1 | I → T. Ref.23 Corresponds to variant rs34728563 [ dbSNP | Ensembl ]. | VAR_041312 | |||||
| Natural variant | 527 | 1 | D → G. Ref.23 Corresponds to variant rs34408667 [ dbSNP | Ensembl ]. | VAR_041313 | |||||
| Natural variant | 665 | 1 | T → I. Ref.23 Corresponds to variant rs2286007 [ dbSNP | Ensembl ]. | VAR_019992 | |||||
| Natural variant | 674 | 1 | T → A. Ref.23 Corresponds to variant rs11833299 [ dbSNP | Ensembl ]. | VAR_041314 | |||||
| Natural variant | 823 | 1 | H → R. Ref.23 Corresponds to variant rs56015776 [ dbSNP | Ensembl ]. | VAR_041315 | |||||
| Natural variant | 1056 | 1 | T → P. Ref.1 Ref.2 Ref.5 Corresponds to variant rs956868 [ dbSNP | Ensembl ]. | VAR_059033 | |||||
| Natural variant | 1199 | 1 | E → G in a colorectal cancer sample; somatic mutation. Ref.22 | VAR_035640 | |||||
| Natural variant | 1506 | 1 | C → S. Ref.1 Ref.2 Ref.5 Corresponds to variant rs7955371 [ dbSNP | Ensembl ]. | VAR_059034 | |||||
| Natural variant | 1546 | 1 | A → V. Ref.23 Corresponds to variant rs56351358 [ dbSNP | Ensembl ]. | VAR_041316 | |||||
| Natural variant | 1799 | 1 | Q → E in breast cancer samples; infiltrating ductal carcinoma; somatic mutation. Ref.22 Ref.23 | VAR_035641 | |||||
| Natural variant | 1808 | 1 | M → I. Ref.1 Ref.2 Ref.23 Corresponds to variant rs12828016 [ dbSNP | Ensembl ]. | VAR_041317 | |||||
| Natural variant | 1823 | 1 | P → L. Ref.23 Corresponds to variant rs17755373 [ dbSNP | Ensembl ]. | VAR_041318 | |||||
| Natural variant | 1957 | 1 | R → H. Ref.23 Corresponds to variant rs36083875 [ dbSNP | Ensembl ]. | VAR_041319 | |||||
| Natural variant | 2190 | 1 | S → C in a breast pleomorphic lobular carcinoma sample; somatic mutation. Ref.23 | VAR_041320 | |||||
| Natural variant | 2362 | 1 | F → L in a lung adenocarcinoma sample; somatic mutation. Ref.23 | VAR_041321 | |||||
| Natural variant | 2380 | 1 | R → W. Ref.23 Corresponds to variant rs56262445 [ dbSNP | Ensembl ]. | VAR_041322 | |||||
Experimental info | |||||||||
| Sequence conflict | 164 | 1 | R → S AA sequence Ref.7 | ||||||
| Sequence conflict | 1836 | 1 | Missing in BAA20802. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "WNK kinases, a novel protein kinase subfamily in multi-cellular organisms." Verissimo F., Jordan P. Oncogene 20:5562-5569(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, CHROMOSOMAL LOCATION, VARIANTS PRO-1056; SER-1506 AND ILE-1808. Tissue: Heart. |
| [2] | NHLBI resequencing and genotyping service (RS&G) Submitted (DEC-2008) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS PRO-1056; SER-1506 AND ILE-1808. |
| [3] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "PSK, a novel STE20-like kinase derived from prostatic carcinoma that activates the JNK MAPK pathway and regulates actin cytoskeletal organisation." Moore T.M., Garg R., Johnson C., Coptcoat M.J., Ridley A.J., Morris J.D.H. J. Biol. Chem. 275:4311-4322(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-668 (ISOFORMS 1/2), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Mammary carcinoma. |
| [5] | "Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro." Nagase T., Ishikawa K., Nakajima D., Ohira M., Seki N., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 4:141-150(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 69-2382 (ISOFORM 2), VARIANTS PRO-1056 AND SER-1506. Tissue: Brain. |
| [6] | "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SEQUENCE REVISION TO N-TERMINUS. |
| [7] | "Nucleoplasmic and cytoplasmic glycoproteins." Hart G.W., Haltiwanger R.S., Holt G.D., Kelly W.G. Ciba Found. Symp. 145:102-118(1989) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 163-175, GLYCOSYLATION. |
| [8] | "Multiple promoters in the WNK1 gene: one controls expression of a kidney-specific kinase-defective isoform." Delaloy C., Lu J., Houot A.-M., Disse-Nicodeme S., Gasc J.-M., Corvol P., Jeunemaitre X. Mol. Cell. Biol. 23:9208-9221(2003) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (N-TERMINUS OF ISOFORM 3), ALTERNATIVE PROMOTER USAGE, ALTERNATIVE SPLICING, TISSUE SPECIFICITY. Tissue: Kidney. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4/5). |
| [10] | "Identification of a novel gene (HSN2) causing hereditary sensory and autonomic neuropathy type II through the study of Canadian genetic isolates." Lafreniere R.G., MacDonald M.L.E., Dube M.-P., MacFarlane J., O'Driscoll M., Brais B., Meilleur S., Brinkman R.R., Dadivas O., Pape T., Platon C., Radomski C., Risler J., Thompson J., Guerra-Escobio A.-M., Davar G., Breakefield X.O., Pimstone S.N. Samuels M.E.Am. J. Hum. Genet. 74:1064-1073(2004) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION (ISOFORMS 4/5), FUNCTION, INVOLVEMENT IN HSAN2A. |
| [11] | "Human hypertension caused by mutations in WNK kinases." Wilson F.H., Disse-Nicodeme S., Choate K.A., Ishikawa K., Nelson-Williams C., Desitter I., Gunel M., Milford D.V., Lipkin G.W., Achard J.-M., Feely M.P., Dussol B., Berland Y., Unwin R.J., Mayan H., Simon D.B., Farfel Z., Jeunemaitre X., Lifton R.P. Science 293:1107-1112(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN PHA2C. |
| [12] | "Two mutations in the HSN2 gene explain the high prevalence of HSAN2 in French Canadians." Roddier K., Thomas T., Marleau G., Gagnon A.M., Dicaire M.J., St Denis A., Gosselin I., Sarrazin A.M., Larbrisseau A., Lambert M., Vanasse M., Gaudet D., Rouleau G.A., Brais B. Neurology 64:1762-1767(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN HSAN2A. |
| [13] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-2002 AND SER-2032, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [14] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1261, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [15] | "Mutations in the nervous system--specific HSN2 exon of WNK1 cause hereditary sensory neuropathy type II." Shekarabi M., Girard N., Riviere J.B., Dion P., Houle M., Toulouse A., Lafreniere R.G., Vercauteren F., Hince P., Laganiere J., Rochefort D., Faivre L., Samuels M., Rouleau G.A. J. Clin. Invest. 118:2496-2505(2008) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS 4 AND 5), INVOLVEMENT IN HSAN2A. |
| [16] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [17] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-19; SER-1261; SER-2011; SER-2012; SER-2027; SER-2029 AND SER-2032, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [18] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1978, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [19] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-19; SER-1261; SER-1978; SER-2032 AND SER-2121, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [20] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [21] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-2027; SER-2029 AND SER-2032, MASS SPECTROMETRY. |
| [22] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] GLY-1199 AND GLU-1799. |
| [23] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] THR-141; VAL-149; GLN-419; THR-509; GLY-527; ILE-665; ALA-674; ARG-823; VAL-1546; GLU-1799; ILE-1808; LEU-1823; HIS-1957; CYS-2190; LEU-2362 AND TRP-2380. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ296290 mRNA. Translation: CAC15059.1. FJ515833 Genomic DNA. Translation: ACS13726.1. FJ515833 Genomic DNA. Translation: ACS13727.1. FJ515833 Genomic DNA. Translation: ACS13728.1. AC004765 Genomic DNA. No translation available. AC004803 Genomic DNA. No translation available. AF061944 mRNA. Translation: AAF31483.1. Sequence problems. AB002342 mRNA. Translation: BAA20802.2. AY231477 mRNA. Translation: AAO46160.1. BC130467 mRNA. Translation: AAI30468.1. Sequence problems. BC130469 mRNA. Translation: AAI30470.1. Sequence problems. BK004108 Genomic DNA. Translation: DAA04494.1. Sequence problems. |
| IPI | IPI00004472. IPI00397592. IPI00412748. IPI00972952. IPI01013396. |
| RefSeq | NP_001171914.1. NM_001184985.1. NP_055638.2. NM_014823.2. NP_061852.3. NM_018979.3. NP_998820.3. NM_213655.4. |
| UniGene | Hs.356604. |
3D structure databases | |
| ProteinModelPortal | Q9H4A3. |
| SMR | Q9H4A3. Positions 210-572. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-32648N. |
| IntAct | Q9H4A3. 49 interactions. |
| MINT | MINT-2879524. |
PTM databases | |
| PhosphoSite | Q9H4A3. |
Polymorphism databases | |
| DMDM | 74709537. |
Proteomic databases | |
| PaxDb | Q9H4A3. |
| PRIDE | Q9H4A3. |
Protocols and materials databases | |
| DNASU | 65125. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000315939; ENSP00000313059; ENSG00000060237. ENST00000340908; ENSP00000341292; ENSG00000060237. ENST00000537687; ENSP00000444465; ENSG00000060237. ENST00000574564; ENSP00000460651; ENSG00000060237. |
| GeneID | 65125. |
| KEGG | hsa:65125. |
| UCSC | uc001qio.4. human. uc001qir.4. human. uc021qss.1. human. uc021qst.1. human. |
Organism-specific databases | |
| CTD | 65125. |
| GeneCards | GC12P000862. |
| H-InvDB | HIX0010312. |
| HGNC | HGNC:14540. WNK1. |
| MIM | 201300. phenotype. 605232. gene. 614492. phenotype. |
| neXtProt | NX_Q9H4A3. |
| Orphanet | 970. Hereditary sensory and autonomic neuropathy type 2. 88940. Pseudohypoaldosteronism type 2C. |
| PharmGKB | PA134944932. PA33782. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0515. |
| HOVERGEN | HBG079897. |
| InParanoid | Q9H4A3. |
| KO | K08867. |
| OrthoDB | EOG4C5CKQ. |
| PhylomeDB | Q9H4A3. |
Gene expression databases | |
| ArrayExpress | Q9H4A3. |
| Bgee | Q9H4A3. |
| CleanEx | HS_WNK1. |
| Genevestigator | Q9H4A3. |
| GermOnline | ENSG00000060237. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR011009. Kinase-like_dom. IPR024678. Kinase_OSR1/WNK_CCT. IPR000719. Prot_kinase_cat_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] |
| Pfam | PF12202. OSR1_C. 1 hit. PF00069. Pkinase. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. False negative. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q9H4A3. |
| ChEMBL | CHEMBL1075173. |
| ChiTaRS | WNK1. human. |
| GenomeRNAi | 65125. |
| NextBio | 67340. |
| SOURCE | Search... |
Entry information
| Entry name | WNK1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H4A3 Secondary accession number(s): A1L4B0 Q9P1S9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
