SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9H4A3

- WNK1_HUMAN

UniProt

Q9H4A3 - WNK1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Serine/threonine-protein kinase WNK1
Gene
WNK1, HSN2, KDP, KIAA0344, PRKWNK1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Serine/threonine kinase which plays an important role in the regulation of electrolyte homeostasis, cell signaling, survival, and proliferation. Acts as an activator and inhibitor of sodium-coupled chloride cotransporters and potassium-coupled chloride cotransporters respectively. Activates SCNN1A, SCNN1B, SCNN1D and SGK1. Controls sodium and chloride ion transport by inhibiting the activity of WNK4, by either phosphorylating the kinase or via an interaction between WNK4 and the autoinhibitory domain of WNK1. WNK4 regulates the activity of the thiazide-sensitive Na-Cl cotransporter, SLC12A3, by phosphorylation. WNK1 may also play a role in actin cytoskeletal reorganization. Phosphorylates NEDD4L.2 Publications

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Cofactori

Magnesium.1 Publication

Enzyme regulationi

By hypertonicity. Activation requires autophosphorylation of Ser-382. Phosphorylation of Ser-378 also promotes increased activity By similarity.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei233 – 2331ATP By similarityBy similarity
Active sitei349 – 3491Proton acceptor By similarityBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi227 – 2359ATP By similarityBy similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB
  2. chloride channel inhibitor activity Source: UniProt
  3. phosphatase binding Source: UniProtKB
  4. protein binding Source: IntAct
  5. protein kinase inhibitor activity Source: UniProtKB-KW
  6. protein serine/threonine kinase activity Source: UniProtKB
Complete GO annotation...

GO - Biological processi

  1. intracellular signal transduction Source: UniProtKB
  2. ion transport Source: UniProtKB
  3. negative regulation of pancreatic juice secretion Source: Ensembl
  4. negative regulation of phosphatase activity Source: UniProtKB
  5. neuron development Source: UniProtKB
  6. peptidyl-threonine phosphorylation Source: ParkinsonsUK-UCL
  7. positive regulation of systemic arterial blood pressure Source: Ensembl
  8. protein phosphorylation Source: UniProtKB
  9. regulation of cellular process Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Protein kinase inhibitor, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_160189. Stimuli-sensing channels.
SignaLinkiQ9H4A3.

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein kinase WNK1 (EC:2.7.11.1)
Alternative name(s):
Erythrocyte 65 kDa protein
Short name:
p65
Kinase deficient protein
Protein kinase lysine-deficient 1
Protein kinase with no lysine 1
Short name:
hWNK1
Gene namesi
Name:WNK1
Synonyms:HSN2, KDP, KIAA0344, PRKWNK1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:14540. WNK1.

Subcellular locationi

Cytoplasm 2 Publications

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Involvement in diseasei

Pseudohypoaldosteronism 2C (PHA2C) [MIM:614492]: An autosomal dominant disorder characterized by severe hypertension, hyperkalemia, hyperchloremia, mild hyperchloremic metabolic acidosis in some cases, and correction of physiologic abnormalities by thiazide diuretics.
Note: The disease is caused by mutations affecting the gene represented in this entry.1 Publication
Neuropathy, hereditary sensory and autonomic, 2A (HSAN2A) [MIM:201300]: A form of hereditary sensory and autonomic neuropathy, a genetically and clinically heterogeneous group of disorders characterized by degeneration of dorsal root and autonomic ganglion cells, and by sensory and/or autonomic abnormalities. HSAN2A is an autosomal recessive disorder characterized by impairment of pain, temperature and touch sensation, onset of symptoms in infancy or early childhood, occurrence of distal extremity pathologies (paronychia, whitlows, ulcers, and Charcot joints), frequent amputations, sensory loss that affects all modalities of sensation (lower and upper limbs and perhaps the trunk as well), absence or diminution of tendon reflexes (usually in all limbs), minimal autonomic dysfunction, absence of sensory nerve action potentials, and virtual absence of myelinated fibers with decreased numbers of unmyelinated fibers in sural nerves.
Note: The disease is caused by mutations affecting the gene represented in this entry.3 Publications

Keywords - Diseasei

Neuropathy

Organism-specific databases

MIMi201300. phenotype.
614492. phenotype.
Orphaneti970. Hereditary sensory and autonomic neuropathy type 2.
88940. Pseudohypoaldosteronism type 2C.
PharmGKBiPA134944932.
PA33782.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 23822382Serine/threonine-protein kinase WNK1
PRO_0000086819Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei19 – 191Phosphoserine2 Publications
Modified residuei378 – 3781Phosphoserine; by autocatalysis By similarityBy similarity
Modified residuei382 – 3821Phosphoserine; by autocatalysis By similarityBy similarity
Modified residuei1261 – 12611Phosphoserine3 Publications
Modified residuei1978 – 19781Phosphoserine2 Publications
Modified residuei2002 – 20021Phosphoserine1 Publication
Modified residuei2011 – 20111Phosphoserine1 Publication
Modified residuei2012 – 20121Phosphoserine1 Publication
Modified residuei2027 – 20271Phosphoserine2 Publications
Modified residuei2029 – 20291Phosphoserine2 Publications
Modified residuei2032 – 20321Phosphoserine4 Publications
Modified residuei2121 – 21211Phosphoserine1 Publication

Post-translational modificationi

O-glycosylated.1 Publication
Ubiquitinated in vitro by the BCR(KLHL3) complex and in vivo by a BCR(KLHL2) complex, leading to proteasomal degradation.2 Publications

Keywords - PTMi

Glycoprotein, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ9H4A3.
PaxDbiQ9H4A3.
PRIDEiQ9H4A3.

PTM databases

PhosphoSiteiQ9H4A3.

Expressioni

Tissue specificityi

Widely expressed, with highest levels observed in the testis, heart, kidney and skeletal muscle. Isoform 3 is kidney-specific and specifically expressed in the distal convoluted tubule (DCT) and connecting tubule (CNT) of the nephron.5 Publications

Gene expression databases

ArrayExpressiQ9H4A3.
BgeeiQ9H4A3.
CleanExiHS_WNK1.
GenevestigatoriQ9H4A3.

Organism-specific databases

HPAiHPA059157.

Interactioni

Subunit structurei

Interacts with SYT2 By similarity. Interacts with WNK3 and WNK4 By similarity. Interacts with KLHL3.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
OXSR1O957472EBI-457907,EBI-620853
PPP1CAP621362EBI-457907,EBI-357253
Syt2P291012EBI-457907,EBI-458017From a different organism.

Protein-protein interaction databases

BioGridi122403. 44 interactions.
DIPiDIP-32648N.
IntActiQ9H4A3. 52 interactions.
MINTiMINT-2879524.

Structurei

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4PWNX-ray1.84A210-482[»]
ProteinModelPortaliQ9H4A3.
SMRiQ9H4A3. Positions 210-572.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini221 – 479259Protein kinase
Add
BLAST

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG0515.
HOVERGENiHBG079897.
InParanoidiQ9H4A3.
KOiK08867.
OrthoDBiEOG7KDF8Z.
PhylomeDBiQ9H4A3.
TreeFamiTF315363.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR024678. Kinase_OSR1/WNK_CCT.
IPR000719. Prot_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF12202. OSR1_C. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 2 hits.
PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative promoter usage and alternative splicing. Align

Note: WNK1 is a complex 33-exons gene, in total 9 WNK1 exons are alternatively spliced, some expressed in a tissue-specific manner. Additional isoforms seems to exist.

Isoform 11 Publication (identifier: Q9H4A3-1) [UniParc]FASTAAdd to Basket

Also known as: L-WNK1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSGGAAEKQS STPGSLFLSP PAPAPKNGSS SDSSVGEKLG AAAADAVTGR     50
TEEYRRRRHT MDKDSRGAAA TTTTTEHRFF RRSVICDSNA TALELPGLPL 100
SLPQPSIPAA VPQSAPPEPH REETVTATAT SQVAQQPPAA AAPGEQAVAG 150
PAPSTVPSST SKDRPVSQPS LVGSKEEPPP ARSGSGGGSA KEPQEERSQQ 200
QDDIEELETK AVGMSNDGRF LKFDIEIGRG SFKTVYKGLD TETTVEVAWC 250
ELQDRKLTKS ERQRFKEEAE MLKGLQHPNI VRFYDSWEST VKGKKCIVLV 300
TELMTSGTLK TYLKRFKVMK IKVLRSWCRQ ILKGLQFLHT RTPPIIHRDL 350
KCDNIFITGP TGSVKIGDLG LATLKRASFA KSVIGTPEFM APEMYEEKYD 400
ESVDVYAFGM CMLEMATSEY PYSECQNAAQ IYRRVTSGVK PASFDKVAIP 450
EVKEIIEGCI RQNKDERYSI KDLLNHAFFQ EETGVRVELA EEDDGEKIAI 500
KLWLRIEDIK KLKGKYKDNE AIEFSFDLER DVPEDVAQEM VESGYVCEGD 550
HKTMAKAIKD RVSLIKRKRE QRQLVREEQE KKKQEESSLK QQVEQSSASQ 600
TGIKQLPSAS TGIPTASTTS ASVSTQVEPE EPEADQHQQL QYQQPSISVL 650
SDGTVDSGQG SSVFTESRVS SQQTVSYGSQ HEQAHSTGTV PGHIPSTVQA 700
QSQPHGVYPP SSVAQGQSQG QPSSSSLTGV SSSQPIQHPQ QQQGIQQTAP 750
PQQTVQYSLS QTSTSSEATT AQPVSQPQAP QVLPQVSAGK QLPVSQPVPT 800
IQGEPQIPVA TQPSVVPVHS GAHFLPVGQP LPTPLLPQYP VSQIPISTPH 850
VSTAQTGFSS LPITMAAGIT QPLLTLASSA TTAAIPGVST VVPSQLPTLL 900
QPVTQLPSQV HPQLLQPAVQ SMGIPANLGQ AAEVPLSSGD VLYQGFPPRL 950
PPQYPGDSNI APSSNVASVC IHSTVLSPPM PTEVLATPGY FPTVVQPYVE 1000
SNLLVPMGGV GGQVQVSQPG GSLAQAPTTS SQQAVLESTQ GVSQVAPAEP 1050
VAVAQTQATQ PTTLASSVDS AHSDVASGMS DGNENVPSSS GRHEGRTTKR 1100
HYRKSVRSRS RHEKTSRPKL RILNVSNKGD RVVECQLETH NRKMVTFKFD 1150
LDGDNPEEIA TIMVNNDFIL AIERESFVDQ VREIIEKADE MLSEDVSVEP 1200
EGDQGLESLQ GKDDYGFSGS QKLEGEFKQP IPASSMPQQI GIPTSSLTQV 1250
VHSAGRRFIV SPVPESRLRE SKVFPSEITD TVAASTAQSP GMNLSHSASS 1300
LSLQQAFSEL RRAQMTEGPN TAPPNFSHTG PTFPVVPPFL SSIAGVPTTA 1350
AATAPVPATS SPPNDISTSV IQSEVTVPTE EGIAGVATST GVVTSGGLPI 1400
PPVSESPVLS SVVSSITIPA VVSISTTSPS LQVPTSTSEI VVSSTALYPS 1450
VTVSATSASA GGSTATPGPK PPAVVSQQAA GSTTVGATLT SVSTTTSFPS 1500
TASQLCIQLS SSTSTPTLAE TVVVSAHSLD KTSHSSTTGL AFSLSAPSSS 1550
SSPGAGVSSY ISQPGGLHPL VIPSVIASTP ILPQAAGPTS TPLLPQVPSI 1600
PPLVQPVANV PAVQQTLIHS QPQPALLPNQ PHTHCPEVDS DTQPKAPGID 1650
DIKTLEEKLR SLFSEHSSSG AQHASVSLET SLVIESTVTP GIPTTAVAPS 1700
KLLTSTTSTC LPPTNLPLGT VALPVTPVVT PGQVSTPVST TTSGVKPGTA 1750
PSKPPLTKAP VLPVGTELPA GTLPSEQLPP FPGPSLTQSQ QPLEDLDAQL 1800
RRTLSPEMIT VTSAVGPVSM AAPTAITEAG TQPQKGVSQV KEGPVLATSS 1850
GAGVFKMGRF QVSVAADGAQ KEGKNKSEDA KSVHFESSTS ESSVLSSSSP 1900
ESTLVKPEPN GITIPGISSD VPESAHKTTA SEAKSDTGQP TKVGRFQVTT 1950
TANKVGRFSV SKTEDKITDT KKEGPVASPP FMDLEQAVLP AVIPKKEKPE 2000
LSEPSHLNGP SSDPEAAFLS RDVDDGSGSP HSPHQLSSKS LPSQNLSQSL 2050
SNSFNSSYMS SDNESDIEDE DLKLELRRLR DKHLKEIQDL QSRQKHEIES 2100
LYTKLGKVPP AVIIPPAAPL SGRRRRPTKS KGSKSSRSSS LGNKSPQLSG 2150
NLSGQSAASV LHPQQTLHPP GNIPESGQNQ LLQPLKPSPS SDNLYSAFTS 2200
DGAISVPSLS APGQGTSSTN TVGATVNSQA AQAQPPAMTS SRKGTFTDDL 2250
HKLVDNWARD AMNLSGRRGS KGHMNYEGPG MARKFSAPGQ LCISMTSNLG 2300
GSAPISAASA TSLGHFTKSM CPPQQYGFPA TPFGAQWSGT GGPAPQPLGQ 2350
FQPVGTASLQ NFNISNLQKS ISNPPGSNLR TT 2382

Note: Strong expression in dorsal root ganglia and spinal cord.

Length:2,382
Mass (Da):250,794
Last modified:May 18, 2010 - v2
Checksum:i426785F98A452A0A
GO
Isoform 21 Publication (identifier: Q9H4A3-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     740-740: Missing.
     792-1037: Missing.

Note: No experimental confirmation available.

Show »
Length:2,135
Mass (Da):225,560
Checksum:i2961D903C013A22C
GO
Isoform 31 Publication (identifier: Q9H4A3-4) [UniParc]FASTAAdd to Basket

Also known as: KS-WNK1, Kidney-Specific

The sequence of this isoform differs from the canonical sequence as follows:
     1-407: Missing.
     408-437: FGMCMLEMATSEYPYSECQNAAQIYRRVTS → MDIKKKDFCSVFVIINSHCCCCPQKDCINE

Note: Kinase-defective isoform. Produced by alternative promoter usage and alternative splicing.

Show »
Length:1,975
Mass (Da):206,646
Checksum:iB03B35C0321782D3
GO
Isoform 41 Publication (identifier: Q9H4A3-5) [UniParc]FASTAAdd to Basket

Also known as: Brain and spinal cord variant

The sequence of this isoform differs from the canonical sequence as follows:
     714-1037: AQGQSQGQPS...TTSSQQAVLE → PRRGRSMSVC...VLPQVSAGKQ

Note: Contains the nervous system-specific exon HSN2. Produced by alternative splicing.

Show »
Length:2,634
Mass (Da):279,538
Checksum:i2F95DCDA28619B4C
GO
Isoform 5 (identifier: Q9H4A3-6) [UniParc]FASTAAdd to Basket

Also known as: Dorsal root ganglia and sciatic nerve variant, DRG and sciatic nerve variant

The sequence of this isoform differs from the canonical sequence as follows:
     713-713: V → VPQSMAHPCG...SSGGSALHPQ
     792-944: Missing.

Note: Contains the nervous system-specific exon HSN2. Produced by alternative splicing.

Show »
Length:2,642
Mass (Da):279,713
Checksum:iD0AB5C95ABFF46A4
GO
Isoform 6 (identifier: Q9H4A3-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     713-713: V → VPQSMAHPCG...SSGGSALHPQ
     2215-2215: G → GCAKFNCASEQVTFKPGGRRTRFLRKMVKKVCPCNQLCR

Note: Contains the nervous system-specific exon HSN2. Produced by alternative splicing.

Show »
Length:2,833
Mass (Da):299,725
Checksum:i24CA46FC81669858
GO

Sequence cautioni

The sequence AAF31483.1 differs from that shown. Reason: Contaminating sequence. Sequence of unknown origin in the C-terminal part.
The sequence AAI30468.1 differs from that shown. Reason: Probable cloning artifact.
The sequence AAI30470.1 differs from that shown. Reason: Probable cloning artifact.
The sequence DAA04494.1 differs from that shown. Reason: Erroneous gene model prediction. Includes 3' and 3' intronic sequences.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti141 – 1411A → T.1 Publication
Corresponds to variant rs11554421 [ dbSNP | Ensembl ].
VAR_041309
Natural varianti149 – 1491A → V.1 Publication
Corresponds to variant rs34880640 [ dbSNP | Ensembl ].
VAR_041310
Natural varianti419 – 4191E → Q in a breast pleomorphic lobular carcinoma sample; somatic mutation. 1 Publication
VAR_041311
Natural varianti509 – 5091I → T.1 Publication
Corresponds to variant rs34728563 [ dbSNP | Ensembl ].
VAR_041312
Natural varianti527 – 5271D → G.1 Publication
Corresponds to variant rs34408667 [ dbSNP | Ensembl ].
VAR_041313
Natural varianti665 – 6651T → I.1 Publication
Corresponds to variant rs2286007 [ dbSNP | Ensembl ].
VAR_019992
Natural varianti674 – 6741T → A.1 Publication
Corresponds to variant rs11833299 [ dbSNP | Ensembl ].
VAR_041314
Natural varianti823 – 8231H → R.1 Publication
Corresponds to variant rs56015776 [ dbSNP | Ensembl ].
VAR_041315
Natural varianti1056 – 10561T → P.3 Publications
Corresponds to variant rs956868 [ dbSNP | Ensembl ].
VAR_059033
Natural varianti1199 – 11991E → G in a colorectal cancer sample; somatic mutation. 1 Publication
VAR_035640
Natural varianti1506 – 15061C → S.3 Publications
Corresponds to variant rs7955371 [ dbSNP | Ensembl ].
VAR_059034
Natural varianti1546 – 15461A → V.1 Publication
Corresponds to variant rs56351358 [ dbSNP | Ensembl ].
VAR_041316
Natural varianti1799 – 17991Q → E in breast cancer samples; infiltrating ductal carcinoma; somatic mutation. 2 Publications
VAR_035641
Natural varianti1808 – 18081M → I.3 Publications
Corresponds to variant rs12828016 [ dbSNP | Ensembl ].
VAR_041317
Natural varianti1823 – 18231P → L.1 Publication
Corresponds to variant rs17755373 [ dbSNP | Ensembl ].
VAR_041318
Natural varianti1957 – 19571R → H.1 Publication
Corresponds to variant rs36083875 [ dbSNP | Ensembl ].
VAR_041319
Natural varianti2190 – 21901S → C in a breast pleomorphic lobular carcinoma sample; somatic mutation. 1 Publication
VAR_041320
Natural varianti2362 – 23621F → L in a lung adenocarcinoma sample; somatic mutation. 1 Publication
VAR_041321
Natural varianti2380 – 23801R → W.1 Publication
Corresponds to variant rs56262445 [ dbSNP | Ensembl ].
VAR_041322

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 407407Missing in isoform 3. 1 Publication
VSP_050634Add
BLAST
Alternative sequencei408 – 43730FGMCM…RRVTS → MDIKKKDFCSVFVIINSHCC CCPQKDCINE in isoform 3. 1 Publication
VSP_050637Add
BLAST
Alternative sequencei713 – 7131V → VPQSMAHPCGGTPTYPESQI FFPTIHERPVSFSPPPTCPP KVAISQRRKSTSFLEAQTHH FQPLLRTVGQSLLPPGGSPT NWTPEAVVMLGTTASRVTGE SCEIQVHPMFEPSQVYSDYR PGLVLPEEAHYFIPQEAVYV AGVHYQARVAEQYEGIPYNS SVLSSPMKQIPEQKPVQGGP TSSSVFEFPSGQAFLVGHLQ NLRLDSGLGPGSPLSSISAP ISTDATRLKFHPVFVPHSAP AVLTHNNESRSNCVFEFHVH TPSSSSGEGGGILPQRVYRN RQVAVDLNQEELPPQSVGLH GYLQPVTEEKHNYHAPELTV SVVEPIGQNWPIGSPEYSSD SSQITSSDPSDFQSPPPTGG AAAPFGSDVSMPFIHLPQTV LQESPLFFCFPQGTTSQQVL TASFSSGGSALHPQ in isoform 5 and isoform 6.
VSP_040267
Alternative sequencei714 – 1037324AQGQS…QAVLE → PRRGRSMSVCVPIFLLLPLC PASLPVLFHPTASTVCTSFS FPPPDCPEETFAEKLSKALE SVLPMHSASQRKHRRSSLPS LFVSTPQSMAHPCGGTPTYP ESQIFFPTIHERPVSFSPPP TCPPKVAISQRRKSTSFLEA QTHHFQPLLRTVGQSLLPPG GSPTNWTPEAVVMLGTTASR VTGESCEIQVHPMFEPSQVY SDYRPGLVLPEEAHYFIPQE AVYVAGVHYQARVAEQYEGI PYNSSVLSSPMKQIPEQKPV QGGPTSSSVFEFPSGQAFLV GHLQNLRLDSGLGPGSPLSS ISAPISTDATRLKFHPVFVP HSAPAVLTHNNESRSNCVFE FHVHTPSSSSGEGGGILPQR VYRNRQVAVDLNQEELPPQS VGLHGYLQPVTEEKHNYHAP ELTVSVVEPIGQNWPIGSPE YSSDSSQITSSDPSDFQSPP PTGGAAAPFGSDVSMPFIHL PQTVLQESPLFFCFPQGTTS QQVLTASFSSGGSALHPQAQ GQSQGQPSSSSLTGVSSSQP IQHPQQQQGIQQTAPPQQTV QYSLSQTSTSSEATTAQPVS QPQAPQVLPQVSAGKQ in isoform 4.
VSP_040268Add
BLAST
Alternative sequencei740 – 7401Missing in isoform 2.
VSP_040269
Alternative sequencei792 – 1037246Missing in isoform 2. 1 Publication
VSP_050638Add
BLAST
Alternative sequencei792 – 944153Missing in isoform 5.
VSP_040270Add
BLAST
Alternative sequencei2215 – 22151G → GCAKFNCASEQVTFKPGGRR TRFLRKMVKKVCPCNQLCR in isoform 6.
VSP_053767

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti164 – 1641R → S AA sequence 1 Publication
Sequence conflicti1836 – 18361Missing in BAA20802. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ296290 mRNA. Translation: CAC15059.1.
JQ358908 mRNA. Translation: AEY99342.1.
FJ515833 Genomic DNA. Translation: ACS13726.1.
FJ515833 Genomic DNA. Translation: ACS13727.1.
FJ515833 Genomic DNA. Translation: ACS13728.1.
AC004765 Genomic DNA. No translation available.
AC004803 Genomic DNA. No translation available.
AF061944 mRNA. Translation: AAF31483.1. Sequence problems.
AB002342 mRNA. Translation: BAA20802.2.
AY231477 mRNA. Translation: AAO46160.1.
BC013629 mRNA. Translation: AAH13629.2.
BC130467 mRNA. Translation: AAI30468.1. Sequence problems.
BC130469 mRNA. Translation: AAI30470.1. Sequence problems.
BK004108 Genomic DNA. Translation: DAA04494.1. Sequence problems.
CCDSiCCDS8506.1. [Q9H4A3-1]
RefSeqiNP_001171914.1. NM_001184985.1. [Q9H4A3-6]
NP_055638.2. NM_014823.2.
NP_061852.3. NM_018979.3. [Q9H4A3-1]
NP_998820.3. NM_213655.4. [Q9H4A3-5]
UniGeneiHs.744906.

Genome annotation databases

EnsembliENST00000315939; ENSP00000313059; ENSG00000060237. [Q9H4A3-1]
ENST00000340908; ENSP00000341292; ENSG00000060237. [Q9H4A3-4]
ENST00000537687; ENSP00000444465; ENSG00000060237. [Q9H4A3-6]
ENST00000574564; ENSP00000460651; ENSG00000060237.
GeneIDi65125.
KEGGihsa:65125.
UCSCiuc001qio.4. human. [Q9H4A3-1]
uc001qir.4. human. [Q9H4A3-2]
uc021qss.1. human. [Q9H4A3-6]
uc021qst.1. human. [Q9H4A3-5]

Polymorphism databases

DMDMi296453029.

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ296290 mRNA. Translation: CAC15059.1 .
JQ358908 mRNA. Translation: AEY99342.1 .
FJ515833 Genomic DNA. Translation: ACS13726.1 .
FJ515833 Genomic DNA. Translation: ACS13727.1 .
FJ515833 Genomic DNA. Translation: ACS13728.1 .
AC004765 Genomic DNA. No translation available.
AC004803 Genomic DNA. No translation available.
AF061944 mRNA. Translation: AAF31483.1 . Sequence problems.
AB002342 mRNA. Translation: BAA20802.2 .
AY231477 mRNA. Translation: AAO46160.1 .
BC013629 mRNA. Translation: AAH13629.2 .
BC130467 mRNA. Translation: AAI30468.1 . Sequence problems.
BC130469 mRNA. Translation: AAI30470.1 . Sequence problems.
BK004108 Genomic DNA. Translation: DAA04494.1 . Sequence problems.
CCDSi CCDS8506.1. [Q9H4A3-1 ]
RefSeqi NP_001171914.1. NM_001184985.1. [Q9H4A3-6 ]
NP_055638.2. NM_014823.2.
NP_061852.3. NM_018979.3. [Q9H4A3-1 ]
NP_998820.3. NM_213655.4. [Q9H4A3-5 ]
UniGenei Hs.744906.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
4PWN X-ray 1.84 A 210-482 [» ]
ProteinModelPortali Q9H4A3.
SMRi Q9H4A3. Positions 210-572.
ModBasei Search...

Protein-protein interaction databases

BioGridi 122403. 44 interactions.
DIPi DIP-32648N.
IntActi Q9H4A3. 52 interactions.
MINTi MINT-2879524.

Chemistry

BindingDBi Q9H4A3.
ChEMBLi CHEMBL1075173.

PTM databases

PhosphoSitei Q9H4A3.

Polymorphism databases

DMDMi 296453029.

Proteomic databases

MaxQBi Q9H4A3.
PaxDbi Q9H4A3.
PRIDEi Q9H4A3.

Protocols and materials databases

DNASUi 65125.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000315939 ; ENSP00000313059 ; ENSG00000060237 . [Q9H4A3-1 ]
ENST00000340908 ; ENSP00000341292 ; ENSG00000060237 . [Q9H4A3-4 ]
ENST00000537687 ; ENSP00000444465 ; ENSG00000060237 . [Q9H4A3-6 ]
ENST00000574564 ; ENSP00000460651 ; ENSG00000060237 .
GeneIDi 65125.
KEGGi hsa:65125.
UCSCi uc001qio.4. human. [Q9H4A3-1 ]
uc001qir.4. human. [Q9H4A3-2 ]
uc021qss.1. human. [Q9H4A3-6 ]
uc021qst.1. human. [Q9H4A3-5 ]

Organism-specific databases

CTDi 65125.
GeneCardsi GC12P000862.
GeneReviewsi WNK1.
H-InvDB HIX0010312.
HGNCi HGNC:14540. WNK1.
HPAi HPA059157.
MIMi 201300. phenotype.
605232. gene.
614492. phenotype.
neXtProti NX_Q9H4A3.
Orphaneti 970. Hereditary sensory and autonomic neuropathy type 2.
88940. Pseudohypoaldosteronism type 2C.
PharmGKBi PA134944932.
PA33782.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0515.
HOVERGENi HBG079897.
InParanoidi Q9H4A3.
KOi K08867.
OrthoDBi EOG7KDF8Z.
PhylomeDBi Q9H4A3.
TreeFami TF315363.

Enzyme and pathway databases

Reactomei REACT_160189. Stimuli-sensing channels.
SignaLinki Q9H4A3.

Miscellaneous databases

ChiTaRSi WNK1. human.
GeneWikii WNK1.
GenomeRNAii 65125.
NextBioi 35528002.
PROi Q9H4A3.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9H4A3.
Bgeei Q9H4A3.
CleanExi HS_WNK1.
Genevestigatori Q9H4A3.

Family and domain databases

InterProi IPR011009. Kinase-like_dom.
IPR024678. Kinase_OSR1/WNK_CCT.
IPR000719. Prot_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view ]
Pfami PF12202. OSR1_C. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view ]
SUPFAMi SSF56112. SSF56112. 2 hits.
PROSITEi PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "WNK kinases, a novel protein kinase subfamily in multi-cellular organisms."
    Verissimo F., Jordan P.
    Oncogene 20:5562-5569(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, CHROMOSOMAL LOCATION, VARIANTS PRO-1056; SER-1506 AND ILE-1808.
    Tissue: Heart.
  2. "A new methodology for quantification of alternatively spliced exons reveals a highly tissue-specific expression pattern of WNK1 isoforms."
    Vidal-Petiot E., Cheval L., Faugeroux J., Malard T., Doucet A., Jeunemaitre X., Hadchouel J.
    PLoS ONE 7:E37751-E37751(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6), ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
    Tissue: Neuron.
  3. NHLBI resequencing and genotyping service (RS&G)
    Submitted (DEC-2008) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS PRO-1056; SER-1506 AND ILE-1808.
  4. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "PSK, a novel STE20-like kinase derived from prostatic carcinoma that activates the JNK MAPK pathway and regulates actin cytoskeletal organisation."
    Moore T.M., Garg R., Johnson C., Coptcoat M.J., Ridley A.J., Morris J.D.H.
    J. Biol. Chem. 275:4311-4322(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-668 (ISOFORMS 1/2), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Mammary carcinoma.
  6. "Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
    Nagase T., Ishikawa K., Nakajima D., Ohira M., Seki N., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 4:141-150(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 69-2382 (ISOFORM 2), VARIANTS PRO-1056 AND SER-1506.
    Tissue: Brain.
  7. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION TO N-TERMINUS.
  8. "Nucleoplasmic and cytoplasmic glycoproteins."
    Hart G.W., Haltiwanger R.S., Holt G.D., Kelly W.G.
    Ciba Found. Symp. 145:102-118(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 163-175, GLYCOSYLATION.
  9. "Multiple promoters in the WNK1 gene: one controls expression of a kidney-specific kinase-defective isoform."
    Delaloy C., Lu J., Houot A.-M., Disse-Nicodeme S., Gasc J.-M., Corvol P., Jeunemaitre X.
    Mol. Cell. Biol. 23:9208-9221(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (N-TERMINUS OF ISOFORM 3), ALTERNATIVE PROMOTER USAGE, ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
    Tissue: Kidney.
  10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1/4/5).
    Tissue: Placenta.
  11. Cited for: IDENTIFICATION (ISOFORMS 4/5), FUNCTION, INVOLVEMENT IN HSAN2A.
  12. Cited for: INVOLVEMENT IN PHA2C.
  13. Cited for: INVOLVEMENT IN HSAN2A.
  14. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-2002 AND SER-2032, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  15. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
    Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
    Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1261, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  16. "Mutations in the nervous system--specific HSN2 exon of WNK1 cause hereditary sensory neuropathy type II."
    Shekarabi M., Girard N., Riviere J.B., Dion P., Houle M., Toulouse A., Lafreniere R.G., Vercauteren F., Hince P., Laganiere J., Rochefort D., Faivre L., Samuels M., Rouleau G.A.
    J. Clin. Invest. 118:2496-2505(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING (ISOFORMS 4 AND 5), INVOLVEMENT IN HSAN2A.
  17. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  18. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-19; SER-1261; SER-2011; SER-2012; SER-2027; SER-2029 AND SER-2032, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  19. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  20. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1978, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  21. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-19; SER-1261; SER-1978; SER-2032 AND SER-2121, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  22. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  23. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-2027; SER-2029 AND SER-2032, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  24. Cited for: UBIQUITINATION BY KLHL2.
  25. "The CUL3-KLHL3 E3 ligase complex mutated in Gordon's hypertension syndrome interacts with and ubiquitylates WNK isoforms: disease-causing mutations in KLHL3 and WNK4 disrupt interaction."
    Ohta A., Schumacher F.R., Mehellou Y., Johnson C., Knebel A., Macartney T.J., Wood N.T., Alessi D.R., Kurz T.
    Biochem. J. 451:111-122(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH KLHL3.
  26. "Kelch-like 3 and Cullin 3 regulate electrolyte homeostasis via ubiquitination and degradation of WNK4."
    Shibata S., Zhang J., Puthumana J., Stone K.L., Lifton R.P.
    Proc. Natl. Acad. Sci. U.S.A. 110:7838-7843(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: UBIQUITINATION, INTERACTION WITH KLHL3.
  27. Cited for: VARIANTS [LARGE SCALE ANALYSIS] GLY-1199 AND GLU-1799.
  28. "Patterns of somatic mutation in human cancer genomes."
    Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
    , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
    Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS [LARGE SCALE ANALYSIS] THR-141; VAL-149; GLN-419; THR-509; GLY-527; ILE-665; ALA-674; ARG-823; VAL-1546; GLU-1799; ILE-1808; LEU-1823; HIS-1957; CYS-2190; LEU-2362 AND TRP-2380.

Entry informationi

Entry nameiWNK1_HUMAN
AccessioniPrimary (citable) accession number: Q9H4A3
Secondary accession number(s): A1L4B0
, C5HTZ5, C5HTZ6, C5HTZ7, H6WZW3, O15052, P54963, Q4VBX9, Q6IFS5, Q86WL5, Q8N673, Q96CZ6, Q9P1S9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 2, 2004
Last sequence update: May 18, 2010
Last modified: September 3, 2014
This is version 145 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi