Reviewed,
UniProtKB/Swiss-Prot Q9H3Z4 (DNJC5_HUMAN)
Last modified
March 2, 2010.
Version 84.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: DnaJ homolog subfamily C member 5 Alternative name(s): Cysteine string protein Short name=CSP | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 198 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | May have an important role in presynaptic function. May be involved in calcium-dependent neurotransmitter release at nerve endings By similarity. |
| Subcellular location | Membrane; Lipid-anchor By similarity. Melanosome. Note: Identified by mass spectrometry in melanosome fractions from stage I to stage IV. Ref.9 |
| Tissue specificity | Expressed in pancreas, kidney, skeletal muscle, liver, lung, placenta, brain and heart. Ref.1 |
| Post-translational modification | Fatty acylated. Heavily palmitoylated in the cysteine string motif By similarity. |
| Sequence similarities | Contains 1 J domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Chaperone |
| PTM | Acetylation Lipoprotein Palmitate Phosphoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | protein folding Inferred from electronic annotation. Source: InterPro |
| Cellular component | melanosome Inferred from electronic annotation. Source: UniProtKB-SubCell mitochondrionInferred from direct assay. Source: HPA plasma membraneInferred from direct assay. Source: HPA |
| Molecular function | heat shock protein binding Inferred from electronic annotation. Source: InterPro unfolded protein bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9H3Z4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9H3Z4-2) The sequence of this isoform differs from the canonical sequence as follows: 165-198: EATDTPIVIQPASATETTQLTADSHPSYHTDGFN → GGH | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 198 | 198 | DnaJ homolog subfamily C member 5 | PRO_0000071052 | |||||
Regions | |||||||||
| Domain | 13 – 82 | 70 | J | ||||||
| Compositional bias | 118 – 128 | 11 | Poly-Cys | ||||||
Amino acid modifications | |||||||||
| Modified residue | 8 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 10 | 1 | Phosphoserine Ref.7 Ref.8 Ref.10 Ref.11 Ref.12 | ||||||
| Modified residue | 11 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 12 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 15 | 1 | Phosphoserine Ref.12 | ||||||
| Modified residue | 17 | 1 | Phosphotyrosine By similarity | ||||||
| Modified residue | 41 | 1 | N6-acetyllysine Ref.14 | ||||||
| Modified residue | 56 | 1 | N6-acetyllysine Ref.14 | ||||||
Natural variations | |||||||||
| Alternative sequence | 165 – 198 | 34 | EATDT…TDGFN → GGH in isoform 2. | VSP_001292 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Widespread expression of human cysteine string proteins." Coppola T., Gundersen C. FEBS Lett. 391:269-272(1996) [PubMed: 8764987] [Abstract] Cited for: NUCLEOTIDE SEQUENCE (ISOFORMS 1 AND 2), TISSUE SPECIFICITY. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Cerebellum and Hippocampus. |
| [3] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed: 11780052] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Blood. |
| [6] | "Characterization of long cDNA clones from human adult spleen." Hattori A., Okumura K., Nagase T., Kikuno R., Hirosawa M., Ohara O. DNA Res. 7:357-366(2000) [PubMed: 11214971] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 76-198. Tissue: Spleen. |
| [7] | "Identification and characterization of phosphorylated proteins in the human pituitary." Giorgianni F., Beranova-Giorgianni S., Desiderio D.M. Proteomics 4:587-598(2004) [PubMed: 14997482] [Abstract] Cited for: PHOSPHORYLATION AT SER-10. Tissue: Pituitary. |
| [8] | "Global phosphoproteome of HT-29 human colon adenocarcinoma cells." Kim J.-E., Tannenbaum S.R., White F.M. J. Proteome Res. 4:1339-1346(2005) [PubMed: 16083285] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-10, MASS SPECTROMETRY. |
| [9] | "Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes." Chi A., Valencia J.C., Hu Z.-Z., Watabe H., Yamaguchi H., Mangini N.J., Huang H., Canfield V.A., Cheng K.C., Yang F., Abe R., Yamagishi S., Shabanowitz J., Hearing V.J., Wu C., Appella E., Hunt D.F. J. Proteome Res. 5:3135-3144(2006) [PubMed: 17081065] [Abstract] Cited for: SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [10] | "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra." Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D. J. Proteome Res. 6:4150-4162(2007) [PubMed: 17924679] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-10, MASS SPECTROMETRY. Tissue: Epithelium. |
| [11] | "Phosphoproteome of resting human platelets." Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A. J. Proteome Res. 7:526-534(2008) [PubMed: 18088087] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-10, MASS SPECTROMETRY. Tissue: Platelet. |
| [12] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-10 AND SER-15, MASS SPECTROMETRY. |
| [13] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed: 19369195] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-10, MASS SPECTROMETRY. |
| [14] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed: 19608861] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-41 AND LYS-56, MASS SPECTROMETRY. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AL118506 Genomic DNA. Translation: CAC15495.1. CH471077 Genomic DNA. Translation: EAW75191.1. BC053642 mRNA. Translation: AAH53642.1. AK024508 mRNA. Translation: BAB15798.1. AK128776 mRNA. Translation: BAG54730.1. AK289585 mRNA. Translation: BAF82274.1. |
| IPI | IPI00023780. IPI00402231. |
| PIR | S70515. |
| RefSeq | NP_079495.1. |
| UniGene | Hs.164419 |
3D structure databases | |
| SMR | Q9H3Z4. Positions 5-100. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9H3Z4. |
PTM databases | |
| PhosphoSite | Q9H3Z4. |
Proteomic databases | |
| PRIDE | Q9H3Z4. |
Genome annotation databases | |
| Ensembl | ENST00000360864; ENSP00000354111; ENSG00000101152; Homo sapiens. [Genome view] |
| GeneID | 80331. |
| KEGG | hsa:80331. |
| UCSC | uc002yhf.1. human. uc002yhg.1. human. |
Organism-specific databases | |
| CTD | 80331. |
| GeneCards | GC20P061996. |
| H-InvDB | HIX0016014. |
| HGNC | HGNC:16235. DNAJC5. |
| HPA | HPA012737. HPA013154. |
| MIM | 611203. gene. |
| PharmGKB | PA27422. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG16509. |
| HOGENOM | HBG713019. |
| HOVERGEN | HBG005414. |
| InParanoid | Q9H3Z4. |
| OMA | AHAILND. |
| OrthoDB | EOG9N0716. |
Gene expression databases | |
| ArrayExpress | Q9H3Z4. |
| Bgee | Q9H3Z4. |
| CleanEx | HS_DNAJC5. |
| Genevestigator | Q9H3Z4. |
| GermOnline | ENSG00000101152. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001623. DnaJ_N. IPR018253. Heat_shock_DnaJ_CS. IPR015609. Hsp40/DnaJ_Rel. IPR003095. Hsp_DnaJ. [Graphical view] |
| Gene3D | G3DSA:1.10.287.110. DnaJ_N. 1 hit. |
| PANTHER | PTHR11821. Hsp40/DnaJ_Rel. 1 hit. |
| Pfam | PF00226. DnaJ. 1 hit. [Graphical view] |
| PRINTS | PR00625. DNAJPROTEIN. |
| SMART | SM00271. DnaJ. 1 hit. [Graphical view] |
| SUPFAM | SSF46565. DnaJ_N. 1 hit. |
| PROSITE | PS00636. DNAJ_1. 1 hit. PS50076. DNAJ_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 70876. |
| SOURCE | Search... |
Entry information
| Entry name | DNJC5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H3Z4 Secondary accession number(s): A8K0M0 Q9H7H2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


