Q9H3U5 (MFSD1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 80.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Major facilitator superfamily domain-containing protein 1 Alternative name(s): Smooth muscle cell-associated protein 4 Short name=SMAP-4 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 465 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subcellular location | Membrane; Multi-pass membrane protein Potential. |
| Sequence similarities | Belongs to the major facilitator superfamily. |
| Sequence caution | The sequence AAH30542.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS. The sequence AAN76517.2 differs from that shown. Reason: Aberrant splicing. The sequence BAB20269.1 differs from that shown. Reason: Frameshift at positions 289, 296 and 305. The sequence BAG57809.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS. The sequence BAG59980.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transport |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | transmembrane transport Inferred from electronic annotation. Source: InterPro |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9H3U5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9H3U5-2) The sequence of this isoform differs from the canonical sequence as follows: 73-78: DMQVNT → MGHNHF 79-465: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 3 (identifier: Q9H3U5-3) The sequence of this isoform differs from the canonical sequence as follows: 55-110: GSYFCYDNPAALQTQVKRDMQVNTTKFMLLYAWYSWPNVVLCFFGGFLIDRVFGIR → AIFAMIILLPFRLKLDE | ||||||
| Isoform 4 (identifier: Q9H3U5-4) The sequence of this isoform differs from the canonical sequence as follows: 1-73: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 465 | 465 | Major facilitator superfamily domain-containing protein 1 | PRO_0000273382 | |||||
Regions | |||||||||
| Transmembrane | 39 – 59 | 21 | Helical; Potential | ||||||
| Transmembrane | 83 – 103 | 21 | Helical; Potential | ||||||
| Transmembrane | 113 – 133 | 21 | Helical; Potential | ||||||
| Transmembrane | 135 – 155 | 21 | Helical; Potential | ||||||
| Transmembrane | 213 – 233 | 21 | Helical; Potential | ||||||
| Transmembrane | 266 – 286 | 21 | Helical; Potential | ||||||
| Transmembrane | 303 – 323 | 21 | Helical; Potential | ||||||
| Transmembrane | 331 – 351 | 21 | Helical; Potential | ||||||
| Transmembrane | 361 – 381 | 21 | Helical; Potential | ||||||
| Transmembrane | 392 – 412 | 21 | Helical; Potential | ||||||
| Transmembrane | 418 – 438 | 21 | Helical; Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 73 | 73 | Missing in isoform 4. | VSP_037578 | |||||
| Alternative sequence | 55 – 110 | 56 | GSYFC…VFGIR → AIFAMIILLPFRLKLDE in isoform 3. | VSP_037579 | |||||
| Alternative sequence | 73 – 78 | 6 | DMQVNT → MGHNHF in isoform 2. | VSP_022537 | |||||
| Alternative sequence | 79 – 465 | 387 | Missing in isoform 2. | VSP_022538 | |||||
| Natural variant | 24 | 1 | P → S. Ref.3 Corresponds to variant rs28364680 [ dbSNP | Ensembl ]. | VAR_030138 | |||||
| Natural variant | 168 | 1 | K → E. Ref.4 Corresponds to variant rs17854200 [ dbSNP | Ensembl ]. | VAR_030139 | |||||
| Natural variant | 220 | 1 | I → V. Ref.3 Ref.4 Corresponds to variant rs3765083 [ dbSNP | Ensembl ]. | VAR_030140 | |||||
| Natural variant | 271 | 1 | I → T. Corresponds to variant rs11551240 [ dbSNP | Ensembl ]. | VAR_059466 | |||||
Experimental info | |||||||||
| Sequence conflict | 275 | 1 | C → R in BAB20269. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and characterization of human smooth muscle cell associated protein-4 (SMAP-4)." Nishimoto S., Toyoda H., Tawara J., Aoki T., Komurasaki T. Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Heart. |
| [2] | "Isolation of full-length cDNA clones from human fetal brain cDNA library." Mao Y., Xie Y. Submitted (NOV-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Fetal brain. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4), VARIANTS SER-24 AND VAL-220. Tissue: Brain, Esophagus and Prostate. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS GLU-168 AND VAL-220. Tissue: Brain, Duodenum and Lung. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB014732 mRNA. Translation: BAB20269.1. Frameshift. AF351617 mRNA. Translation: AAN76517.2. Sequence problems. AK024215 mRNA. Translation: BAB14852.1. AK294628 mRNA. Translation: BAG57809.1. Sequence problems. AK297593 mRNA. Translation: BAG59980.1. Different initiation. AK300497 mRNA. Translation: BAG62211.1. AK301680 mRNA. Translation: BAG63153.1. BC030542 mRNA. Translation: AAH30542.1. Sequence problems. BC042197 mRNA. Translation: AAH42197.1. |
| IPI | IPI00747136. IPI00797353. IPI00937543. IPI00942906. |
| RefSeq | NP_001161375.1. NM_001167903.1. NP_073573.2. NM_022736.2. |
| UniGene | Hs.58663. |
3D structure databases | |
| ProteinModelPortal | Q9H3U5. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-4723047. |
PTM databases | |
| PhosphoSite | Q9H3U5. |
Polymorphism databases | |
| DMDM | 124015158. |
Proteomic databases | |
| PaxDb | Q9H3U5. |
| PRIDE | Q9H3U5. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000264266; ENSP00000264266; ENSG00000118855. |
| GeneID | 64747. |
| KEGG | hsa:64747. |
| UCSC | uc003fcl.2. human. |
Organism-specific databases | |
| CTD | 64747. |
| GeneCards | GC03P158449. |
| HGNC | HGNC:25874. MFSD1. |
| neXtProt | NX_Q9H3U5. |
| PharmGKB | PA134947356. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0477. |
| HOVERGEN | HBG081969. |
| InParanoid | Q9H3U5. |
| PhylomeDB | Q9H3U5. |
Gene expression databases | |
| ArrayExpress | Q9H3U5. |
| Bgee | Q9H3U5. |
| CleanEx | HS_MFSD1. |
| Genevestigator | Q9H3U5. |
Family and domain databases | |
| InterPro | IPR011701. MFS. IPR020846. MFS_dom. IPR016196. MFS_dom_general_subst_transpt. [Graphical view] |
| Pfam | PF07690. MFS_1. 1 hit. [Graphical view] |
| SUPFAM | SSF103473. MFS_gen_substrate_transporter. 1 hit. |
| PROSITE | PS50850. MFS. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 64747. |
| NextBio | 66701. |
Entry information
| Entry name | MFSD1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H3U5 Secondary accession number(s): B4DGJ8 Q9H7X1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
