Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

UPF0696 protein C11orf68

Gene

C11orf68

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • poly(A) RNA binding Source: UniProtKB
Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:ENSG00000175573-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
UPF0696 protein C11orf68
Alternative name(s):
Basophilic leukemia-expressed protein Bles03
Protein p5326
Gene namesi
Name:C11orf68
Synonyms:BLES03
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:28801. C11orf68.

Pathology & Biotechi

Organism-specific databases

DisGeNETi83638.
OpenTargetsiENSG00000175573.
PharmGKBiPA144596487.

Polymorphism and mutation databases

BioMutaiC11orf68.
DMDMi325511329.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002281171 – 251UPF0696 protein C11orf68Add BLAST251

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: Q9H3H3-2)
Modified residuei29Omega-N-methylarginineCombined sources1
Isoform 3 (identifier: Q9H3H3-3)
Modified residuei29Omega-N-methylarginineCombined sources1

Keywords - PTMi

Methylation

Proteomic databases

EPDiQ9H3H3.
MaxQBiQ9H3H3.
PaxDbiQ9H3H3.
PeptideAtlasiQ9H3H3.
PRIDEiQ9H3H3.

PTM databases

iPTMnetiQ9H3H3.
PhosphoSitePlusiQ9H3H3.

Expressioni

Gene expression databases

BgeeiENSG00000175573.
CleanExiHS_C11orf68.
GenevisibleiQ9H3H3. HS.

Organism-specific databases

HPAiHPA045938.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
EIF4HQ150564EBI-721765,EBI-748492
NONOQ152333EBI-721765,EBI-350527
RELQ048643EBI-721765,EBI-307352
SDCBPO005603EBI-721765,EBI-727004

Protein-protein interaction databases

BioGridi123702. 9 interactors.
IntActiQ9H3H3. 10 interactors.
MINTiMINT-8247514.
STRINGi9606.ENSP00000398350.

Structurei

Secondary structure

1251
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi18 – 20Combined sources3
Helixi22 – 28Combined sources7
Beta strandi38 – 41Combined sources4
Turni42 – 44Combined sources3
Helixi47 – 49Combined sources3
Helixi50 – 56Combined sources7
Turni59 – 61Combined sources3
Beta strandi79 – 82Combined sources4
Helixi93 – 106Combined sources14
Helixi112 – 122Combined sources11
Beta strandi127 – 133Combined sources7
Helixi137 – 151Combined sources15
Beta strandi156 – 160Combined sources5
Beta strandi165 – 167Combined sources3
Beta strandi170 – 177Combined sources8
Helixi182 – 194Combined sources13
Beta strandi201 – 205Combined sources5
Helixi206 – 210Combined sources5
Beta strandi225 – 230Combined sources6
Beta strandi233 – 236Combined sources4
Beta strandi239 – 243Combined sources5
Turni244 – 247Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1ZTPX-ray2.50A/B/C1-251[»]
2Q4KX-ray2.50A/B/C1-251[»]
ProteinModelPortaliQ9H3H3.
SMRiQ9H3H3.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9H3H3.

Family & Domainsi

Sequence similaritiesi

Belongs to the UPF0696 family.Curated

Phylogenomic databases

eggNOGiENOG410IFB5. Eukaryota.
ENOG4112CDG. LUCA.
GeneTreeiENSGT00390000011640.
HOGENOMiHOG000111738.
HOVERGENiHBG054338.
InParanoidiQ9H3H3.
OMAiFDAHTTP.
OrthoDBiEOG091G0FTK.
PhylomeDBiQ9H3H3.
TreeFamiTF331797.

Family and domain databases

Gene3Di3.30.760.10. 1 hit.
InterProiIPR015034. DUF1917.
IPR023398. TIF_eIF4e-like.
[Graphical view]
PfamiPF08939. DUF1917. 1 hit.
[Graphical view]
SUPFAMiSSF55418. SSF55418. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H3H3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEPGEELEEE GSPGGREDGF TAEHLAAEAM AADMDPWLVF DARTTPATEL
60 70 80 90 100
DAWLAKYPPS QVTRYGDPGS PNSEPVGWIA VYGQGYSPNS GDVQGLQAAW
110 120 130 140 150
EALQTSGRPI TPGTLRQLAI THHVLSGKWL MHLAPGFKLD HAWAGIARAV
160 170 180 190 200
VEGQLQVAKV SPRAKEGGRQ VICVYTDDFT DRLGVLEADS AIRAAGIKCL
210 220 230 240 250
LTYKPDVYTY LGIYRANRWH LCPTLYESRF QLGGSARGSR VLDRANNVEL

T
Length:251
Mass (Da):27,355
Last modified:March 8, 2011 - v2
Checksum:i52AABD8BCF242E75
GO
Isoform 2 (identifier: Q9H3H3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAAAAAAAVAGVGRGGGGAEPRQERSRARGWAGVERSEGRRM

Show »
Length:292
Mass (Da):31,430
Checksum:i4FE98CC31A406CDA
GO
Isoform 3 (identifier: Q9H3H3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAAAAAAAVAGVGRGGGGAEPRQERSRARGWAGVERSEGRSRM

Show »
Length:293
Mass (Da):31,517
Checksum:iEFD2FEAF1DB44A11
GO

Sequence cautioni

The sequence AAH13185 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_060319154Q → R.2 PublicationsCorresponds to variant rs7947504dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0407411M → MAAAAAAAVAGVGRGGGGAE PRQERSRARGWAGVERSEGR RM in isoform 2. 1 Publication1
Alternative sequenceiVSP_0408901M → MAAAAAAAVAGVGRGGGGAE PRQERSRARGWAGVERSEGR SRM in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF073483 mRNA. Translation: AAG43171.1.
CR607649 mRNA. No translation available.
AP006287 Genomic DNA. No translation available.
BC004414 mRNA. Translation: AAH04414.1.
BC010512 mRNA. Translation: AAH10512.1.
BC013185 mRNA. Translation: AAH13185.1. Different initiation.
CCDSiCCDS44652.1. [Q9H3H3-3]
CCDS8122.2. [Q9H3H3-2]
RefSeqiNP_001129107.1. NM_001135635.1. [Q9H3H3-3]
NP_113638.2. NM_031450.3. [Q9H3H3-2]
UniGeneiHs.433573.

Genome annotation databases

EnsembliENST00000438576; ENSP00000398350; ENSG00000175573. [Q9H3H3-3]
ENST00000449692; ENSP00000409681; ENSG00000175573. [Q9H3H3-2]
ENST00000530188; ENSP00000433914; ENSG00000175573. [Q9H3H3-1]
GeneIDi83638.
KEGGihsa:83638.
UCSCiuc001ogi.4. human. [Q9H3H3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF073483 mRNA. Translation: AAG43171.1.
CR607649 mRNA. No translation available.
AP006287 Genomic DNA. No translation available.
BC004414 mRNA. Translation: AAH04414.1.
BC010512 mRNA. Translation: AAH10512.1.
BC013185 mRNA. Translation: AAH13185.1. Different initiation.
CCDSiCCDS44652.1. [Q9H3H3-3]
CCDS8122.2. [Q9H3H3-2]
RefSeqiNP_001129107.1. NM_001135635.1. [Q9H3H3-3]
NP_113638.2. NM_031450.3. [Q9H3H3-2]
UniGeneiHs.433573.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1ZTPX-ray2.50A/B/C1-251[»]
2Q4KX-ray2.50A/B/C1-251[»]
ProteinModelPortaliQ9H3H3.
SMRiQ9H3H3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123702. 9 interactors.
IntActiQ9H3H3. 10 interactors.
MINTiMINT-8247514.
STRINGi9606.ENSP00000398350.

PTM databases

iPTMnetiQ9H3H3.
PhosphoSitePlusiQ9H3H3.

Polymorphism and mutation databases

BioMutaiC11orf68.
DMDMi325511329.

Proteomic databases

EPDiQ9H3H3.
MaxQBiQ9H3H3.
PaxDbiQ9H3H3.
PeptideAtlasiQ9H3H3.
PRIDEiQ9H3H3.

Protocols and materials databases

DNASUi83638.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000438576; ENSP00000398350; ENSG00000175573. [Q9H3H3-3]
ENST00000449692; ENSP00000409681; ENSG00000175573. [Q9H3H3-2]
ENST00000530188; ENSP00000433914; ENSG00000175573. [Q9H3H3-1]
GeneIDi83638.
KEGGihsa:83638.
UCSCiuc001ogi.4. human. [Q9H3H3-1]

Organism-specific databases

CTDi83638.
DisGeNETi83638.
GeneCardsiC11orf68.
HGNCiHGNC:28801. C11orf68.
HPAiHPA045938.
neXtProtiNX_Q9H3H3.
OpenTargetsiENSG00000175573.
PharmGKBiPA144596487.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IFB5. Eukaryota.
ENOG4112CDG. LUCA.
GeneTreeiENSGT00390000011640.
HOGENOMiHOG000111738.
HOVERGENiHBG054338.
InParanoidiQ9H3H3.
OMAiFDAHTTP.
OrthoDBiEOG091G0FTK.
PhylomeDBiQ9H3H3.
TreeFamiTF331797.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000175573-MONOMER.

Miscellaneous databases

ChiTaRSiC11orf68. human.
EvolutionaryTraceiQ9H3H3.
GenomeRNAii83638.
PROiQ9H3H3.

Gene expression databases

BgeeiENSG00000175573.
CleanExiHS_C11orf68.
GenevisibleiQ9H3H3. HS.

Family and domain databases

Gene3Di3.30.760.10. 1 hit.
InterProiIPR015034. DUF1917.
IPR023398. TIF_eIF4e-like.
[Graphical view]
PfamiPF08939. DUF1917. 1 hit.
[Graphical view]
SUPFAMiSSF55418. SSF55418. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiCK068_HUMAN
AccessioniPrimary (citable) accession number: Q9H3H3
Secondary accession number(s): J3KQG9, Q9BT13
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: March 8, 2011
Last modified: November 30, 2016
This is version 112 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families
  6. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.