Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

UPF0696 protein C11orf68

Gene

C11orf68

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • poly(A) RNA binding Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
UPF0696 protein C11orf68
Alternative name(s):
Basophilic leukemia-expressed protein Bles03
Protein p5326
Gene namesi
Name:C11orf68
Synonyms:BLES03
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:28801. C11orf68.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA144596487.

Polymorphism and mutation databases

BioMutaiC11orf68.
DMDMi325511329.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 251251UPF0696 protein C11orf68PRO_0000228117Add
BLAST

Proteomic databases

EPDiQ9H3H3.
MaxQBiQ9H3H3.
PaxDbiQ9H3H3.
PeptideAtlasiQ9H3H3.
PRIDEiQ9H3H3.

PTM databases

iPTMnetiQ9H3H3.
PhosphoSiteiQ9H3H3.

Expressioni

Gene expression databases

BgeeiQ9H3H3.
CleanExiHS_C11orf68.
GenevisibleiQ9H3H3. HS.

Organism-specific databases

HPAiHPA045938.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
EIF4HQ150564EBI-721765,EBI-748492
NONOQ152333EBI-721765,EBI-350527
RELQ048643EBI-721765,EBI-307352
SDCBPO005603EBI-721765,EBI-727004

Protein-protein interaction databases

BioGridi123702. 9 interactions.
IntActiQ9H3H3. 7 interactions.
MINTiMINT-8247514.
STRINGi9606.ENSP00000398350.

Structurei

Secondary structure

1
251
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi18 – 203Combined sources
Helixi22 – 287Combined sources
Beta strandi38 – 414Combined sources
Turni42 – 443Combined sources
Helixi47 – 493Combined sources
Helixi50 – 567Combined sources
Turni59 – 613Combined sources
Beta strandi79 – 824Combined sources
Helixi93 – 10614Combined sources
Helixi112 – 12211Combined sources
Beta strandi127 – 1337Combined sources
Helixi137 – 15115Combined sources
Beta strandi156 – 1605Combined sources
Beta strandi165 – 1673Combined sources
Beta strandi170 – 1778Combined sources
Helixi182 – 19413Combined sources
Beta strandi201 – 2055Combined sources
Helixi206 – 2105Combined sources
Beta strandi225 – 2306Combined sources
Beta strandi233 – 2364Combined sources
Beta strandi239 – 2435Combined sources
Turni244 – 2474Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1ZTPX-ray2.50A/B/C1-251[»]
2Q4KX-ray2.50A/B/C1-251[»]
ProteinModelPortaliQ9H3H3.
SMRiQ9H3H3. Positions 17-251.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9H3H3.

Family & Domainsi

Sequence similaritiesi

Belongs to the UPF0696 family.Curated

Phylogenomic databases

eggNOGiENOG410IFB5. Eukaryota.
ENOG4112CDG. LUCA.
GeneTreeiENSGT00390000011640.
HOGENOMiHOG000111738.
HOVERGENiHBG054338.
InParanoidiQ9H3H3.
OMAiFDAHTTP.
OrthoDBiEOG7CRTQP.
PhylomeDBiQ9H3H3.
TreeFamiTF331797.

Family and domain databases

Gene3Di3.30.760.10. 1 hit.
InterProiIPR015034. DUF1917.
IPR023398. TIF_eIF4e-like.
[Graphical view]
PfamiPF08939. DUF1917. 1 hit.
[Graphical view]
SUPFAMiSSF55418. SSF55418. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H3H3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEPGEELEEE GSPGGREDGF TAEHLAAEAM AADMDPWLVF DARTTPATEL
60 70 80 90 100
DAWLAKYPPS QVTRYGDPGS PNSEPVGWIA VYGQGYSPNS GDVQGLQAAW
110 120 130 140 150
EALQTSGRPI TPGTLRQLAI THHVLSGKWL MHLAPGFKLD HAWAGIARAV
160 170 180 190 200
VEGQLQVAKV SPRAKEGGRQ VICVYTDDFT DRLGVLEADS AIRAAGIKCL
210 220 230 240 250
LTYKPDVYTY LGIYRANRWH LCPTLYESRF QLGGSARGSR VLDRANNVEL

T
Length:251
Mass (Da):27,355
Last modified:March 8, 2011 - v2
Checksum:i52AABD8BCF242E75
GO
Isoform 2 (identifier: Q9H3H3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAAAAAAAVAGVGRGGGGAEPRQERSRARGWAGVERSEGRRM

Show »
Length:292
Mass (Da):31,430
Checksum:i4FE98CC31A406CDA
GO
Isoform 3 (identifier: Q9H3H3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAAAAAAAVAGVGRGGGGAEPRQERSRARGWAGVERSEGRSRM

Show »
Length:293
Mass (Da):31,517
Checksum:iEFD2FEAF1DB44A11
GO

Sequence cautioni

The sequence AAH13185.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti154 – 1541Q → R.2 Publications
Corresponds to variant rs7947504 [ dbSNP | Ensembl ].
VAR_060319

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MAAAAAAAVAGVGRGGGGAE PRQERSRARGWAGVERSEGR RM in isoform 2. 1 PublicationVSP_040741
Alternative sequencei1 – 11M → MAAAAAAAVAGVGRGGGGAE PRQERSRARGWAGVERSEGR SRM in isoform 3. 1 PublicationVSP_040890

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF073483 mRNA. Translation: AAG43171.1.
CR607649 mRNA. No translation available.
AP006287 Genomic DNA. No translation available.
BC004414 mRNA. Translation: AAH04414.1.
BC010512 mRNA. Translation: AAH10512.1.
BC013185 mRNA. Translation: AAH13185.1. Different initiation.
CCDSiCCDS44652.1. [Q9H3H3-3]
CCDS8122.2. [Q9H3H3-2]
RefSeqiNP_001129107.1. NM_001135635.1. [Q9H3H3-3]
NP_113638.2. NM_031450.3. [Q9H3H3-2]
UniGeneiHs.433573.

Genome annotation databases

EnsembliENST00000438576; ENSP00000398350; ENSG00000175573. [Q9H3H3-3]
ENST00000449692; ENSP00000409681; ENSG00000175573. [Q9H3H3-2]
ENST00000530188; ENSP00000433914; ENSG00000175573. [Q9H3H3-1]
GeneIDi83638.
KEGGihsa:83638.
UCSCiuc001ogi.4. human. [Q9H3H3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF073483 mRNA. Translation: AAG43171.1.
CR607649 mRNA. No translation available.
AP006287 Genomic DNA. No translation available.
BC004414 mRNA. Translation: AAH04414.1.
BC010512 mRNA. Translation: AAH10512.1.
BC013185 mRNA. Translation: AAH13185.1. Different initiation.
CCDSiCCDS44652.1. [Q9H3H3-3]
CCDS8122.2. [Q9H3H3-2]
RefSeqiNP_001129107.1. NM_001135635.1. [Q9H3H3-3]
NP_113638.2. NM_031450.3. [Q9H3H3-2]
UniGeneiHs.433573.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1ZTPX-ray2.50A/B/C1-251[»]
2Q4KX-ray2.50A/B/C1-251[»]
ProteinModelPortaliQ9H3H3.
SMRiQ9H3H3. Positions 17-251.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123702. 9 interactions.
IntActiQ9H3H3. 7 interactions.
MINTiMINT-8247514.
STRINGi9606.ENSP00000398350.

PTM databases

iPTMnetiQ9H3H3.
PhosphoSiteiQ9H3H3.

Polymorphism and mutation databases

BioMutaiC11orf68.
DMDMi325511329.

Proteomic databases

EPDiQ9H3H3.
MaxQBiQ9H3H3.
PaxDbiQ9H3H3.
PeptideAtlasiQ9H3H3.
PRIDEiQ9H3H3.

Protocols and materials databases

DNASUi83638.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000438576; ENSP00000398350; ENSG00000175573. [Q9H3H3-3]
ENST00000449692; ENSP00000409681; ENSG00000175573. [Q9H3H3-2]
ENST00000530188; ENSP00000433914; ENSG00000175573. [Q9H3H3-1]
GeneIDi83638.
KEGGihsa:83638.
UCSCiuc001ogi.4. human. [Q9H3H3-1]

Organism-specific databases

CTDi83638.
GeneCardsiC11orf68.
HGNCiHGNC:28801. C11orf68.
HPAiHPA045938.
neXtProtiNX_Q9H3H3.
PharmGKBiPA144596487.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IFB5. Eukaryota.
ENOG4112CDG. LUCA.
GeneTreeiENSGT00390000011640.
HOGENOMiHOG000111738.
HOVERGENiHBG054338.
InParanoidiQ9H3H3.
OMAiFDAHTTP.
OrthoDBiEOG7CRTQP.
PhylomeDBiQ9H3H3.
TreeFamiTF331797.

Miscellaneous databases

ChiTaRSiC11orf68. human.
EvolutionaryTraceiQ9H3H3.
GenomeRNAii83638.
PROiQ9H3H3.

Gene expression databases

BgeeiQ9H3H3.
CleanExiHS_C11orf68.
GenevisibleiQ9H3H3. HS.

Family and domain databases

Gene3Di3.30.760.10. 1 hit.
InterProiIPR015034. DUF1917.
IPR023398. TIF_eIF4e-like.
[Graphical view]
PfamiPF08939. DUF1917. 1 hit.
[Graphical view]
SUPFAMiSSF55418. SSF55418. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Zhang J.S.S., Reddel R.R.
    Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-154.
    Tissue: Mesenchymal cell.
  2. "Full-length cDNA libraries and normalization."
    Li W.B., Gruber C., Jessee J., Polayes D.
    Submitted (JUL-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Placenta.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT ARG-154.
    Tissue: Adrenal cortex, Brain and Pancreas.
  5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  6. "The structure at 2.5 A resolution of human basophilic leukemia-expressed protein BLES03."
    Bitto E., Bingman C.A., Robinson H., Allard S.T.M., Wesenberg G.E., Phillips G.N. Jr.
    Acta Crystallogr. F 61:812-817(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS).
  7. "Ensemble refinement of protein crystal structures: validation and application."
    Levin E.J., Kondrashov D.A., Wesenberg G.E., Phillips G.N. Jr.
    Structure 15:1040-1052(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS).

Entry informationi

Entry nameiCK068_HUMAN
AccessioniPrimary (citable) accession number: Q9H3H3
Secondary accession number(s): J3KQG9, Q9BT13
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: March 8, 2011
Last modified: July 6, 2016
This is version 108 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families
  6. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.