Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein tweety homolog 1

Gene

TTYH1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Probable chloride channel. May be involved in cell adhesion (By similarity).By similarity
Isoform 3 may be a Ca2+-independent and swelling-activated chloride channel, possibly involved in regulation of cell volume.

GO - Molecular functioni

  • calcium ion binding Source: Ensembl
  • iron ion transmembrane transporter activity Source: UniProtKB
  • volume-sensitive chloride channel activity Source: FlyBase

GO - Biological processi

  • cell-substrate adhesion Source: Ensembl
  • chloride transport Source: FlyBase
  • filopodium assembly Source: Ensembl
  • ion transmembrane transport Source: Reactome
  • iron ion transmembrane transport Source: GOC
  • iron ion transport Source: UniProtKB
  • mitotic nuclear division Source: Ensembl
  • regulation of anion transport Source: GOC
  • single organismal cell-cell adhesion Source: Ensembl
  • transmembrane transport Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Chloride channel, Ion channel

Keywords - Biological processi

Cell adhesion, Ion transport, Transport

Keywords - Ligandi

Chloride

Enzyme and pathway databases

ReactomeiR-HSA-2672351. Stimuli-sensing channels.

Protein family/group databases

TCDBi1.A.48.1.2. the anion channel tweety (tweety) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein tweety homolog 1
Short name:
hTTY1
Gene namesi
Name:TTYH1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:13476. TTYH1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 4343ExtracellularSequence analysisAdd
BLAST
Transmembranei44 – 6421Helical; Name=1Sequence analysisAdd
BLAST
Topological domaini65 – 8824CytoplasmicSequence analysisAdd
BLAST
Transmembranei89 – 10921Helical; Name=2Sequence analysisAdd
BLAST
Topological domaini110 – 214105ExtracellularSequence analysisAdd
BLAST
Transmembranei215 – 23521Helical; Name=3Sequence analysisAdd
BLAST
Topological domaini236 – 2405CytoplasmicSequence analysis
Transmembranei241 – 26121Helical; Name=4Sequence analysisAdd
BLAST
Topological domaini262 – 390129ExtracellularSequence analysisAdd
BLAST
Transmembranei391 – 41121Helical; Name=5Sequence analysisAdd
BLAST
Topological domaini412 – 45039CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA37778.

Polymorphism and mutation databases

BioMutaiTTYH1.
DMDMi74718142.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 450450Protein tweety homolog 1PRO_0000312239Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi130 – 1301N-linked (GlcNAc...)Sequence analysis
Glycosylationi205 – 2051N-linked (GlcNAc...)Sequence analysis
Glycosylationi284 – 2841N-linked (GlcNAc...)Sequence analysis
Glycosylationi355 – 3551N-linked (GlcNAc...)Sequence analysis
Modified residuei440 – 4401PhosphoserineBy similarity

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ9H313.
PRIDEiQ9H313.

PTM databases

PhosphoSiteiQ9H313.

Expressioni

Tissue specificityi

Expressed in brain, eye, ovary and testis, and at lower levels in muscle, placenta, liver and lung.1 Publication

Gene expression databases

BgeeiQ9H313.
ExpressionAtlasiQ9H313. baseline and differential.
GenevisibleiQ9H313. HS.

Organism-specific databases

HPAiHPA023617.
HPA050655.

Interactioni

Protein-protein interaction databases

BioGridi121494. 1 interaction.
STRINGi9606.ENSP00000365714.

Structurei

3D structure databases

ProteinModelPortaliQ9H313.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi424 – 43310Poly-Asp

Sequence similaritiesi

Belongs to the tweety family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4433. Eukaryota.
ENOG410ZNTN. LUCA.
GeneTreeiENSGT00390000010182.
HOVERGENiHBG108621.
InParanoidiQ9H313.
OMAiLNSTHFN.
PhylomeDBiQ9H313.
TreeFamiTF319025.

Family and domain databases

InterProiIPR006990. Tweety.
[Graphical view]
PANTHERiPTHR12424. PTHR12424. 1 hit.
PfamiPF04906. Tweety. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H313-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGAPPGYRPS AWVHLLHQLP RADFQLRPVP SVFAPQEQEY QQALLLVAAL
60 70 80 90 100
AGLGLGLSLI FIAVYLIRFC CCRPPEPPGS KIPSPGGGCV TWSCIVALLA
110 120 130 140 150
GCTGIGIGFY GNSETSDGVS QLSSALLHAN HTLSTIDHLV LETVERLGEA
160 170 180 190 200
VRTELTTLEE VLEPRTELVA AARGARRQAE AAAQQLQGLA FWQGVPLSPL
210 220 230 240 250
QVAENVSFVE EYRWLAYVLL LLLELLVCLF TLLGLAKQSK WLVIVMTVMS
260 270 280 290 300
LLVLVLSWGS MGLEAATAVG LSDFCSNPDP YVLNLTQEET GLSSDILSYY
310 320 330 340 350
LLCNRAVSNP FQQRLTLSQR ALANIHSQLL GLEREAVPQF PSAQKPLLSL
360 370 380 390 400
EETLNVTEGN FHQLVALLHC RSLHKDYGAA LRGLCEDALE GLLFLLLFSL
410 420 430 440 450
LSAGALATAL CSLPRAWALF PPSDDYDDTD DDDPFNPQES KRFVQWQSSI
Length:450
Mass (Da):49,051
Last modified:March 1, 2001 - v1
Checksum:iAD3DA4569F083657
GO
Isoform 2 (identifier: Q9H313-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     437-437: P → PQ

Show »
Length:451
Mass (Da):49,179
Checksum:i02C3FECCEC7EAC3D
GO
Isoform 3 (identifier: Q9H313-3) [UniParc]FASTAAdd to basket

Also known as: TTYH1s

The sequence of this isoform differs from the canonical sequence as follows:
     423-450: SDDYDDTDDDDPFNPQESKRFVQWQSSI → RNPSALCSGSRLSEPLLPAGLEPGSPLRSFPGCRRRPH

Show »
Length:460
Mass (Da):49,770
Checksum:i60E044715B59032F
GO
Isoform 4 (identifier: Q9H313-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-212: Missing.
     213-213: R → M
     437-437: P → PQ

Note: No experimental confirmation available.
Show »
Length:239
Mass (Da):26,489
Checksum:i0AB57E2FD3E890B4
GO
Isoform 5 (identifier: Q9H313-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-85: Missing.
     86-101: GGGCVTWSCIVALLAG → MEKVRLWRGSESRAAI
     140-142: Missing.
     376-450: DYGAALRGLC...KRFVQWQSSI → VKPLPSQFLLPRGASVSTHRTTSSFSLDPCHCA

Note: No experimental confirmation available.
Show »
Length:320
Mass (Da):35,119
Checksum:i37D888ECF630256B
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti380 – 3801A → S in BAD20189 (PubMed:15010458).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 212212Missing in isoform 4. 1 PublicationVSP_029753Add
BLAST
Alternative sequencei1 – 8585Missing in isoform 5. 1 PublicationVSP_029754Add
BLAST
Alternative sequencei86 – 10116GGGCV…ALLAG → MEKVRLWRGSESRAAI in isoform 5. 1 PublicationVSP_029755Add
BLAST
Alternative sequencei140 – 1423Missing in isoform 5. 1 PublicationVSP_029756
Alternative sequencei213 – 2131R → M in isoform 4. 1 PublicationVSP_029757
Alternative sequencei376 – 45075DYGAA…WQSSI → VKPLPSQFLLPRGASVSTHR TTSSFSLDPCHCA in isoform 5. 1 PublicationVSP_029758Add
BLAST
Alternative sequencei423 – 45028SDDYD…WQSSI → RNPSALCSGSRLSEPLLPAG LEPGSPLRSFPGCRRRPH in isoform 3. 3 PublicationsVSP_029759Add
BLAST
Alternative sequencei437 – 4371P → PQ in isoform 2 and isoform 4. 2 PublicationsVSP_029760

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF177909 mRNA. Translation: AAG02580.1.
AB162930 mRNA. Translation: BAD20189.1.
AB188496 mRNA. Translation: BAD37142.1.
AK126690 mRNA. Translation: BAC86645.1.
AK289468 mRNA. Translation: BAF82157.1.
CU207370 Genomic DNA. Translation: CAQ52428.1.
CU207370 Genomic DNA. Translation: CAQ52429.1.
CU207370 Genomic DNA. Translation: CAQ52430.1.
CU207370 Genomic DNA. Translation: CAQ52431.1.
CU467002 Genomic DNA. Translation: CAQ08949.1.
CU467002 Genomic DNA. Translation: CAQ08950.1.
CU467002 Genomic DNA. Translation: CAQ08951.1.
CH471135 Genomic DNA. Translation: EAW72240.1.
CH471135 Genomic DNA. Translation: EAW72242.1.
BC011347 mRNA. Translation: AAH11347.1.
BC019358 mRNA. Translation: AAH19358.1.
CCDSiCCDS12893.1. [Q9H313-1]
CCDS33106.1. [Q9H313-3]
CCDS56102.1. [Q9H313-2]
RefSeqiNP_001005367.1. NM_001005367.2. [Q9H313-3]
NP_001188390.1. NM_001201461.1. [Q9H313-2]
NP_065710.1. NM_020659.3. [Q9H313-1]
UniGeneiHs.268728.

Genome annotation databases

EnsembliENST00000301194; ENSP00000301194; ENSG00000167614. [Q9H313-2]
ENST00000376530; ENSP00000365713; ENSG00000167614. [Q9H313-1]
ENST00000376531; ENSP00000365714; ENSG00000167614. [Q9H313-3]
ENST00000611133; ENSP00000480177; ENSG00000276887. [Q9H313-2]
ENST00000611471; ENSP00000484881; ENSG00000275650. [Q9H313-3]
ENST00000611711; ENSP00000484774; ENSG00000276887. [Q9H313-1]
ENST00000614387; ENSP00000484077; ENSG00000276887. [Q9H313-4]
ENST00000614458; ENSP00000484835; ENSG00000276887. [Q9H313-3]
ENST00000616929; ENSP00000479779; ENSG00000276537. [Q9H313-2]
ENST00000619450; ENSP00000480769; ENSG00000275650. [Q9H313-1]
ENST00000619453; ENSP00000484548; ENSG00000276537. [Q9H313-3]
ENST00000619591; ENSP00000481601; ENSG00000275650. [Q9H313-2]
ENST00000620133; ENSP00000483288; ENSG00000276887. [Q9H313-5]
ENST00000620298; ENSP00000481138; ENSG00000276537. [Q9H313-1]
ENST00000622771; ENSP00000482372; ENSG00000276537. [Q9H313-4]
GeneIDi57348.
KEGGihsa:57348.
UCSCiuc002qfq.4. human. [Q9H313-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF177909 mRNA. Translation: AAG02580.1.
AB162930 mRNA. Translation: BAD20189.1.
AB188496 mRNA. Translation: BAD37142.1.
AK126690 mRNA. Translation: BAC86645.1.
AK289468 mRNA. Translation: BAF82157.1.
CU207370 Genomic DNA. Translation: CAQ52428.1.
CU207370 Genomic DNA. Translation: CAQ52429.1.
CU207370 Genomic DNA. Translation: CAQ52430.1.
CU207370 Genomic DNA. Translation: CAQ52431.1.
CU467002 Genomic DNA. Translation: CAQ08949.1.
CU467002 Genomic DNA. Translation: CAQ08950.1.
CU467002 Genomic DNA. Translation: CAQ08951.1.
CH471135 Genomic DNA. Translation: EAW72240.1.
CH471135 Genomic DNA. Translation: EAW72242.1.
BC011347 mRNA. Translation: AAH11347.1.
BC019358 mRNA. Translation: AAH19358.1.
CCDSiCCDS12893.1. [Q9H313-1]
CCDS33106.1. [Q9H313-3]
CCDS56102.1. [Q9H313-2]
RefSeqiNP_001005367.1. NM_001005367.2. [Q9H313-3]
NP_001188390.1. NM_001201461.1. [Q9H313-2]
NP_065710.1. NM_020659.3. [Q9H313-1]
UniGeneiHs.268728.

3D structure databases

ProteinModelPortaliQ9H313.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121494. 1 interaction.
STRINGi9606.ENSP00000365714.

Protein family/group databases

TCDBi1.A.48.1.2. the anion channel tweety (tweety) family.

PTM databases

PhosphoSiteiQ9H313.

Polymorphism and mutation databases

BioMutaiTTYH1.
DMDMi74718142.

Proteomic databases

PaxDbiQ9H313.
PRIDEiQ9H313.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000301194; ENSP00000301194; ENSG00000167614. [Q9H313-2]
ENST00000376530; ENSP00000365713; ENSG00000167614. [Q9H313-1]
ENST00000376531; ENSP00000365714; ENSG00000167614. [Q9H313-3]
ENST00000611133; ENSP00000480177; ENSG00000276887. [Q9H313-2]
ENST00000611471; ENSP00000484881; ENSG00000275650. [Q9H313-3]
ENST00000611711; ENSP00000484774; ENSG00000276887. [Q9H313-1]
ENST00000614387; ENSP00000484077; ENSG00000276887. [Q9H313-4]
ENST00000614458; ENSP00000484835; ENSG00000276887. [Q9H313-3]
ENST00000616929; ENSP00000479779; ENSG00000276537. [Q9H313-2]
ENST00000619450; ENSP00000480769; ENSG00000275650. [Q9H313-1]
ENST00000619453; ENSP00000484548; ENSG00000276537. [Q9H313-3]
ENST00000619591; ENSP00000481601; ENSG00000275650. [Q9H313-2]
ENST00000620133; ENSP00000483288; ENSG00000276887. [Q9H313-5]
ENST00000620298; ENSP00000481138; ENSG00000276537. [Q9H313-1]
ENST00000622771; ENSP00000482372; ENSG00000276537. [Q9H313-4]
GeneIDi57348.
KEGGihsa:57348.
UCSCiuc002qfq.4. human. [Q9H313-1]

Organism-specific databases

CTDi57348.
GeneCardsiTTYH1.
HGNCiHGNC:13476. TTYH1.
HPAiHPA023617.
HPA050655.
MIMi605784. gene.
neXtProtiNX_Q9H313.
PharmGKBiPA37778.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4433. Eukaryota.
ENOG410ZNTN. LUCA.
GeneTreeiENSGT00390000010182.
HOVERGENiHBG108621.
InParanoidiQ9H313.
OMAiLNSTHFN.
PhylomeDBiQ9H313.
TreeFamiTF319025.

Enzyme and pathway databases

ReactomeiR-HSA-2672351. Stimuli-sensing channels.

Miscellaneous databases

ChiTaRSiTTYH1. human.
GenomeRNAii57348.
NextBioi63468.
PROiQ9H313.
SOURCEiSearch...

Gene expression databases

BgeeiQ9H313.
ExpressionAtlasiQ9H313. baseline and differential.
GenevisibleiQ9H313. HS.

Family and domain databases

InterProiIPR006990. Tweety.
[Graphical view]
PANTHERiPTHR12424. PTHR12424. 1 hit.
PfamiPF04906. Tweety. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Human and mouse homologues of the Drosophila melanogaster tweety (tty) gene: a novel gene family encoding predicted transmembrane proteins."
    Campbell H.D., Kamei M., Claudianos C., Woollatt E., Sutherland G.R., Suzuki Y., Hida M., Sugano S., Young I.G.
    Genomics 68:89-92(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "A novel human Cl(-) channel family related to Drosophila flightless locus."
    Suzuki M., Mizuno A.
    J. Biol. Chem. 279:22461-22468(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION (ISOFORM 3).
  3. "Homo sapiens mRNA."
    Sugiyama A., Inoue H., Oka M.
    Submitted (AUG-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Brain.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 5).
    Tissue: Cerebellum.
  5. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
    Tissue: Brain and Placenta.
  8. Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiTTYH1_HUMAN
AccessioniPrimary (citable) accession number: Q9H313
Secondary accession number(s): B0VJY3
, B0VJY4, B0VJY5, B2VAL9, Q5U682, Q68A17, Q6L750, Q6ZTE5, Q8WUU2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: March 1, 2001
Last modified: March 16, 2016
This is version 100 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.