Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9H310

- RHBG_HUMAN

UniProt

Q9H310 - RHBG_HUMAN

Protein

Ammonium transporter Rh type B

Gene

RHBG

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 98 (01 Oct 2014)
      Sequence version 2 (14 Oct 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Functions as a specific ammonium transporter.2 Publications

    GO - Molecular functioni

    1. ammonium transmembrane transporter activity Source: UniProtKB
    2. ankyrin binding Source: UniProtKB

    GO - Biological processi

    1. ammonium transmembrane transport Source: GOC
    2. ammonium transport Source: UniProtKB
    3. transepithelial ammonium transport Source: UniProtKB
    4. transmembrane transport Source: Reactome

    Keywords - Biological processi

    Ammonia transport, Transport

    Enzyme and pathway databases

    ReactomeiREACT_20508. Rhesus glycoproteins mediate ammonium transport.

    Protein family/group databases

    TCDBi1.A.11.4.2. the ammonia transporter channel (amt) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Ammonium transporter Rh type B
    Alternative name(s):
    Rhesus blood group family type B glycoprotein
    Short name:
    Rh family type B glycoprotein
    Short name:
    Rh type B glycoprotein
    Gene namesi
    Name:RHBG
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:14572. RHBG.

    Subcellular locationi

    GO - Cellular componenti

    1. anchored component of plasma membrane Source: UniProtKB
    2. basolateral plasma membrane Source: UniProtKB
    3. cytoplasmic vesicle membrane Source: UniProtKB-SubCell
    4. integral component of plasma membrane Source: UniProtKB
    5. plasma membrane Source: UniProtKB
    6. spectrin-associated cytoskeleton Source: UniProtKB

    Keywords - Cellular componenti

    Cell membrane, Cytoplasmic vesicle, Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi419 – 4191F → A: Loss of interaction with ANK3. Intracellular retention; when associated with A-420 and A-421. 1 Publication
    Mutagenesisi420 – 4201L → A: Partial loss of interaction with ANK3. Intracellular retention; when associated with A-419 and A-421. 1 Publication
    Mutagenesisi421 – 4211D → A: Partial loss of interaction with ANK3. Intracellular retention; when associated with A-419 and A-420. 1 Publication

    Organism-specific databases

    PharmGKBiPA34385.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 441441Ammonium transporter Rh type BPRO_0000283597Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi49 – 491N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    N-glycosylated.By similarity

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PaxDbiQ9H310.
    PRIDEiQ9H310.

    Expressioni

    Tissue specificityi

    Specifically expressed in kidney. Also detected in liver and ovary.1 Publication

    Developmental stagei

    Fetally expressed by kidney and to a lower extent in liver.1 Publication

    Gene expression databases

    ArrayExpressiQ9H310.
    BgeeiQ9H310.
    GenevestigatoriQ9H310.

    Organism-specific databases

    HPAiHPA048489.

    Interactioni

    Subunit structurei

    Interacts (via C-terminus) with ANK2 and ANK3; required for targeting to the basolateral membrane.1 Publication

    Protein-protein interaction databases

    BioGridi121390. 1 interaction.
    IntActiQ9H310. 1 interaction.
    STRINGi9606.ENSP00000255013.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9H310.
    SMRiQ9H310. Positions 12-423.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 1313CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini35 – 6127ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini83 – 864CytoplasmicSequence Analysis
    Topological domaini108 – 12417ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini146 – 1494CytoplasmicSequence Analysis
    Topological domaini171 – 1788ExtracellularSequence Analysis
    Topological domaini202 – 21918CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini241 – 25111ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini273 – 28210CytoplasmicSequence Analysis
    Topological domaini304 – 3041ExtracellularSequence Analysis
    Topological domaini326 – 34621CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini368 – 39326ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini415 – 44127CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei14 – 3421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei62 – 8221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei87 – 10721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei125 – 14521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei150 – 17021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei179 – 20123HelicalSequence AnalysisAdd
    BLAST
    Transmembranei220 – 24021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei252 – 27221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei283 – 30321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei305 – 32521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei347 – 36721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei394 – 41421HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni416 – 4249Interaction with ANK3

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG276393.
    HOVERGENiHBG004374.
    KOiK06580.
    PhylomeDBiQ9H310.
    TreeFamiTF314450.

    Family and domain databases

    Gene3Di1.10.3430.10. 1 hit.
    InterProiIPR029020. Ammonium/urea_transptr.
    IPR024041. NH4_transpt_AmtB-like_dom.
    IPR002229. RhesusRHD.
    [Graphical view]
    PfamiPF00909. Ammonium_transp. 1 hit.
    [Graphical view]
    PRINTSiPR00342. RHESUSRHD.
    SUPFAMiSSF111352. SSF111352. 1 hit.

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9H310-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAGSPSRAAG RRLQLPLLCL FLQGATAVLF AVFVRYNHKT DAALWHRSNH    50
    SNADNEFYFR YPSFQDVHAM VFVGFGFLMV FLQRYGFSSV GFTFLLAAFA 100
    LQWSTLVQGF LHSFHGGHIH VGVESMINAD FCAGAVLISF GAVLGKTGPT 150
    QLLLMALLEV VLFGINEFVL LHLLGVRDAG GSMTIHTFGA YFGLVLSRVL 200
    YRPQLEKSKH RQGSVYHSDL FAMIGTIFLW IFWPSFNAAL TALGAGQHRT 250
    ALNTYYSLAA STLGTFALSA LVGEDGRLDM VHIQNAALAG GVVVGTSSEM 300
    MLTPFGALAA GFLAGTVSTL GYKFFTPILE SKFKVQDTCG VHNLHGMPGV 350
    LGALLGVLVA GLATHEAYGD GLESVFPLIA EGQRSATSQA MHQLFGLFVT 400
    LMFASVGGGL GGLLLKLPFL DSPPRLPALR GPSSLAGAWR A 441
    Length:441
    Mass (Da):47,231
    Last modified:October 14, 2008 - v2
    Checksum:i21EE1FE592F2E1EE
    GO
    Isoform 2 (identifier: Q9H310-2) [UniParc]FASTAAdd to Basket

    Also known as: RhBG-2A

    The sequence of this isoform differs from the canonical sequence as follows:
         1-30: Missing.
         31-63: AVFVRYNHKTDAALWHRSNHSNADNEFYFRYPS → MNFTFATQKSLTLLPRLECNGAISAHCNLHLPG

    Note: No experimental confirmation available.

    Show »
    Length:411
    Mass (Da):43,675
    Checksum:iB9C06223F4445B97
    GO
    Isoform 3 (identifier: Q9H310-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-69: Missing.
         175-175: G → GVRVWGGMESGVGGGQGQPLSQERGGGGGVLPLTPPPQ

    Note: No experimental confirmation available.

    Show »
    Length:409
    Mass (Da):42,978
    Checksum:iD0FE23FCAC1344ED
    GO
    Isoform 4 (identifier: Q9H310-4) [UniParc]FASTAAdd to Basket

    Also known as: RhBG-1A

    The sequence of this isoform differs from the canonical sequence as follows:
         1-69: Missing.

    Show »
    Length:372
    Mass (Da):39,396
    Checksum:i47C840C8A19763F5
    GO
    Isoform 5 (identifier: Q9H310-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-69: Missing.
         372-441: Missing.

    Show »
    Length:302
    Mass (Da):32,092
    Checksum:iB758ABDDBA1E2E90
    GO

    Sequence cautioni

    The sequence AAG01086.1 differs from that shown. Reason: Frameshift at position 425.
    The sequence AAL05978.1 differs from that shown. Reason: Frameshift at position 425.
    The sequence AAN34363.1 differs from that shown. Reason: Frameshift at position 425.
    The sequence AAN34364.1 differs from that shown. Reason: Frameshift at position 425.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti76 – 761G → D.2 Publications
    Corresponds to variant rs2245623 [ dbSNP | Ensembl ].
    VAR_031497
    Natural varianti143 – 1431V → D.1 Publication
    Corresponds to variant rs11586833 [ dbSNP | Ensembl ].
    VAR_031498
    Natural varianti315 – 3151G → R.1 Publication
    Corresponds to variant rs3748569 [ dbSNP | Ensembl ].
    VAR_031499
    Natural varianti339 – 3391C → R.
    Corresponds to variant rs3748567 [ dbSNP | Ensembl ].
    VAR_053637

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6969Missing in isoform 3, isoform 4 and isoform 5. 3 PublicationsVSP_024340Add
    BLAST
    Alternative sequencei1 – 3030Missing in isoform 2. 1 PublicationVSP_024341Add
    BLAST
    Alternative sequencei31 – 6333AVFVR…FRYPS → MNFTFATQKSLTLLPRLECN GAISAHCNLHLPG in isoform 2. 1 PublicationVSP_024342Add
    BLAST
    Alternative sequencei175 – 1751G → GVRVWGGMESGVGGGQGQPL SQERGGGGGVLPLTPPPQ in isoform 3. 1 PublicationVSP_024343
    Alternative sequencei372 – 44170Missing in isoform 5. 1 PublicationVSP_037136Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF193807 mRNA. Translation: AAG01086.1. Frameshift.
    AF219980
    , AF219977, AF219978, AF219979 Genomic DNA. Translation: AAL05978.1. Frameshift.
    AY139092 mRNA. Translation: AAN34363.1. Frameshift.
    AY139093 mRNA. Translation: AAN34364.1. Frameshift.
    AK054780 mRNA. Translation: BAG51423.1.
    AK290840 mRNA. Translation: BAF83529.1.
    AL589685, AL139130 Genomic DNA. Translation: CAI14175.1.
    AL589685, AL139130 Genomic DNA. Translation: CAI14176.1.
    AL589685, AL139130 Genomic DNA. Translation: CAI14177.1.
    AL139130, AL589685 Genomic DNA. Translation: CAI12178.1.
    AL139130, AL589685 Genomic DNA. Translation: CAI12179.1.
    AL139130, AL589685 Genomic DNA. Translation: CAI12180.1.
    CH471121 Genomic DNA. Translation: EAW52961.1.
    BC065218 mRNA. Translation: AAH65218.1.
    RefSeqiNP_001243324.1. NM_001256395.1.
    NP_001243325.1. NM_001256396.1.
    NP_065140.3. NM_020407.4.
    UniGeneiHs.131835.

    Genome annotation databases

    EnsembliENST00000255013; ENSP00000255013; ENSG00000132677. [Q9H310-4]
    ENST00000368249; ENSP00000357232; ENSG00000132677. [Q9H310-1]
    ENST00000400992; ENSP00000383777; ENSG00000132677. [Q9H310-3]
    GeneIDi57127.
    KEGGihsa:57127.
    UCSCiuc009wrz.4. human. [Q9H310-3]
    uc010pho.3. human. [Q9H310-1]
    uc031pqo.1. human. [Q9H310-2]

    Polymorphism databases

    DMDMi209572666.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF193807 mRNA. Translation: AAG01086.1 . Frameshift.
    AF219980
    , AF219977 , AF219978 , AF219979 Genomic DNA. Translation: AAL05978.1 . Frameshift.
    AY139092 mRNA. Translation: AAN34363.1 . Frameshift.
    AY139093 mRNA. Translation: AAN34364.1 . Frameshift.
    AK054780 mRNA. Translation: BAG51423.1 .
    AK290840 mRNA. Translation: BAF83529.1 .
    AL589685 , AL139130 Genomic DNA. Translation: CAI14175.1 .
    AL589685 , AL139130 Genomic DNA. Translation: CAI14176.1 .
    AL589685 , AL139130 Genomic DNA. Translation: CAI14177.1 .
    AL139130 , AL589685 Genomic DNA. Translation: CAI12178.1 .
    AL139130 , AL589685 Genomic DNA. Translation: CAI12179.1 .
    AL139130 , AL589685 Genomic DNA. Translation: CAI12180.1 .
    CH471121 Genomic DNA. Translation: EAW52961.1 .
    BC065218 mRNA. Translation: AAH65218.1 .
    RefSeqi NP_001243324.1. NM_001256395.1.
    NP_001243325.1. NM_001256396.1.
    NP_065140.3. NM_020407.4.
    UniGenei Hs.131835.

    3D structure databases

    ProteinModelPortali Q9H310.
    SMRi Q9H310. Positions 12-423.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 121390. 1 interaction.
    IntActi Q9H310. 1 interaction.
    STRINGi 9606.ENSP00000255013.

    Protein family/group databases

    TCDBi 1.A.11.4.2. the ammonia transporter channel (amt) family.

    Polymorphism databases

    DMDMi 209572666.

    Proteomic databases

    PaxDbi Q9H310.
    PRIDEi Q9H310.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000255013 ; ENSP00000255013 ; ENSG00000132677 . [Q9H310-4 ]
    ENST00000368249 ; ENSP00000357232 ; ENSG00000132677 . [Q9H310-1 ]
    ENST00000400992 ; ENSP00000383777 ; ENSG00000132677 . [Q9H310-3 ]
    GeneIDi 57127.
    KEGGi hsa:57127.
    UCSCi uc009wrz.4. human. [Q9H310-3 ]
    uc010pho.3. human. [Q9H310-1 ]
    uc031pqo.1. human. [Q9H310-2 ]

    Organism-specific databases

    CTDi 57127.
    GeneCardsi GC01P156339.
    HGNCi HGNC:14572. RHBG.
    HPAi HPA048489.
    MIMi 607079. gene.
    neXtProti NX_Q9H310.
    PharmGKBi PA34385.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG276393.
    HOVERGENi HBG004374.
    KOi K06580.
    PhylomeDBi Q9H310.
    TreeFami TF314450.

    Enzyme and pathway databases

    Reactomei REACT_20508. Rhesus glycoproteins mediate ammonium transport.

    Miscellaneous databases

    GeneWikii RHBG.
    GenomeRNAii 57127.
    NextBioi 63029.
    PROi Q9H310.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9H310.
    Bgeei Q9H310.
    Genevestigatori Q9H310.

    Family and domain databases

    Gene3Di 1.10.3430.10. 1 hit.
    InterProi IPR029020. Ammonium/urea_transptr.
    IPR024041. NH4_transpt_AmtB-like_dom.
    IPR002229. RhesusRHD.
    [Graphical view ]
    Pfami PF00909. Ammonium_transp. 1 hit.
    [Graphical view ]
    PRINTSi PR00342. RHESUSRHD.
    SUPFAMi SSF111352. SSF111352. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Rh type B glycoprotein is a new member of the Rh superfamily and a putative ammonia transporter in mammals."
      Liu Z., Peng J., Mo R., Hui C.-C., Huang C.-H.
      J. Biol. Chem. 276:1424-1433(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), DEVELOPMENTAL STAGE, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, GLYCOSYLATION.
      Tissue: Liver.
    2. "Characterization of alternatively spliced Rh type B glycoprotein (RhBG) isoforms in human tissues resulting from exonic inclusion of Alu repeat like sequences."
      Liu Z., Chen Y., Huang C.-H.
      Submitted (AUG-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 4).
      Tissue: Liver.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), VARIANT ASP-76.
      Tissue: Cerebellum and Liver.
    4. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ASP-76.
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANTS ASP-143 AND ARG-315.
      Tissue: Ovary.
    7. "Electroneutral ammonium transport by basolateral rhesus B glycoprotein."
      Ludewig U.
      J. Physiol. (Lond.) 559:751-759(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    8. "Human Rhesus B and Rhesus C glycoproteins: properties of facilitated ammonium transport in recombinant kidney cells."
      Zidi-Yahiaoui N., Mouro-Chanteloup I., D'Ambrosio A.-M., Lopez C., Gane P., Le van Kim C., Cartron J.-P., Colin Y., Ripoche P.
      Biochem. J. 391:33-40(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    9. "The ammonium transporter RhBG: requirement of a tyrosine-based signal and ankyrin-G for basolateral targeting and membrane anchorage in polarized kidney epithelial cells."
      Lopez C., Metral S., Eladari D., Drevensek S., Gane P., Chambrey R., Bennett V., Cartron J.-P., Le Van Kim C., Colin Y.
      J. Biol. Chem. 280:8221-8228(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, MUTAGENESIS OF PHE-419; LEU-420 AND ASP-421, INTERACTION WITH ANK2 AND ANK3.

    Entry informationi

    Entry nameiRHBG_HUMAN
    AccessioniPrimary (citable) accession number: Q9H310
    Secondary accession number(s): A8K475
    , Q5SZW4, Q5SZW6, Q5SZW7, Q6P193, Q6YJI2, Q6YJI3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 3, 2007
    Last sequence update: October 14, 2008
    Last modified: October 1, 2014
    This is version 98 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3