Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ammonium transporter Rh type B

Gene

RHBG

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Functions as a specific ammonium transporter.2 Publications

GO - Molecular functioni

  • ammonium transmembrane transporter activity Source: UniProtKB
  • ankyrin binding Source: UniProtKB

GO - Biological processi

  • ammonium transport Source: UniProtKB
  • nitrogen utilization Source: GO_Central
  • organic cation transport Source: GO_Central
  • transepithelial ammonium transport Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Ammonia transport, Transport

Enzyme and pathway databases

BioCyciZFISH:ENSG00000132677-MONOMER.
ReactomeiR-HSA-444411. Rhesus glycoproteins mediate ammonium transport.

Protein family/group databases

TCDBi1.A.11.4.2. the ammonium transporter channel (amt) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Ammonium transporter Rh type B
Alternative name(s):
Rhesus blood group family type B glycoprotein
Short name:
Rh family type B glycoprotein
Short name:
Rh type B glycoprotein
Gene namesi
Name:RHBG
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:14572. RHBG.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 13CytoplasmicSequence analysisAdd BLAST13
Transmembranei14 – 34HelicalSequence analysisAdd BLAST21
Topological domaini35 – 61ExtracellularSequence analysisAdd BLAST27
Transmembranei62 – 82HelicalSequence analysisAdd BLAST21
Topological domaini83 – 86CytoplasmicSequence analysis4
Transmembranei87 – 107HelicalSequence analysisAdd BLAST21
Topological domaini108 – 124ExtracellularSequence analysisAdd BLAST17
Transmembranei125 – 145HelicalSequence analysisAdd BLAST21
Topological domaini146 – 149CytoplasmicSequence analysis4
Transmembranei150 – 170HelicalSequence analysisAdd BLAST21
Topological domaini171 – 178ExtracellularSequence analysis8
Transmembranei179 – 201HelicalSequence analysisAdd BLAST23
Topological domaini202 – 219CytoplasmicSequence analysisAdd BLAST18
Transmembranei220 – 240HelicalSequence analysisAdd BLAST21
Topological domaini241 – 251ExtracellularSequence analysisAdd BLAST11
Transmembranei252 – 272HelicalSequence analysisAdd BLAST21
Topological domaini273 – 282CytoplasmicSequence analysis10
Transmembranei283 – 303HelicalSequence analysisAdd BLAST21
Topological domaini304ExtracellularSequence analysis1
Transmembranei305 – 325HelicalSequence analysisAdd BLAST21
Topological domaini326 – 346CytoplasmicSequence analysisAdd BLAST21
Transmembranei347 – 367HelicalSequence analysisAdd BLAST21
Topological domaini368 – 393ExtracellularSequence analysisAdd BLAST26
Transmembranei394 – 414HelicalSequence analysisAdd BLAST21
Topological domaini415 – 441CytoplasmicSequence analysisAdd BLAST27

GO - Cellular componenti

  • anchored component of plasma membrane Source: UniProtKB
  • basolateral plasma membrane Source: UniProtKB
  • cytoplasmic vesicle membrane Source: UniProtKB-SubCell
  • integral component of plasma membrane Source: UniProtKB
  • plasma membrane Source: UniProtKB
  • spectrin-associated cytoskeleton Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasmic vesicle, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi419F → A: Loss of interaction with ANK3. Intracellular retention; when associated with A-420 and A-421. 1 Publication1
Mutagenesisi420L → A: Partial loss of interaction with ANK3. Intracellular retention; when associated with A-419 and A-421. 1 Publication1
Mutagenesisi421D → A: Partial loss of interaction with ANK3. Intracellular retention; when associated with A-419 and A-420. 1 Publication1

Organism-specific databases

PharmGKBiPA34385.

Polymorphism and mutation databases

BioMutaiRHBG.
DMDMi209572666.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002835971 – 441Ammonium transporter Rh type BAdd BLAST441

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi49N-linked (GlcNAc...)Sequence analysis1

Post-translational modificationi

N-glycosylated.By similarity

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ9H310.
PRIDEiQ9H310.

PTM databases

PhosphoSitePlusiQ9H310.

Expressioni

Tissue specificityi

Specifically expressed in kidney. Also detected in liver and ovary.1 Publication

Developmental stagei

Fetally expressed by kidney and to a lower extent in liver.1 Publication

Gene expression databases

BgeeiENSG00000132677.
ExpressionAtlasiQ9H310. baseline and differential.
GenevisibleiQ9H310. HS.

Organism-specific databases

HPAiHPA042726.
HPA048489.

Interactioni

Subunit structurei

Interacts (via C-terminus) with ANK2 and ANK3; required for targeting to the basolateral membrane.1 Publication

GO - Molecular functioni

  • ankyrin binding Source: UniProtKB

Protein-protein interaction databases

BioGridi121390. 1 interactor.
IntActiQ9H310. 2 interactors.
STRINGi9606.ENSP00000357229.

Structurei

3D structure databases

ProteinModelPortaliQ9H310.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni416 – 424Interaction with ANK31 Publication9

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3796. Eukaryota.
ENOG410XTF8. LUCA.
HOVERGENiHBG004374.
InParanoidiQ9H310.
KOiK06580.
OrthoDBiEOG091G06KX.
PhylomeDBiQ9H310.
TreeFamiTF314450.

Family and domain databases

Gene3Di1.10.3430.10. 1 hit.
InterProiIPR029020. Ammonium/urea_transptr.
IPR001905. Ammonium_transpt.
IPR024041. NH4_transpt_AmtB-like_dom.
IPR002229. RhesusRHD.
[Graphical view]
PANTHERiPTHR11730. PTHR11730. 1 hit.
PfamiPF00909. Ammonium_transp. 1 hit.
[Graphical view]
PRINTSiPR00342. RHESUSRHD.
SUPFAMiSSF111352. SSF111352. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H310-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGSPSRAAG RRLQLPLLCL FLQGATAVLF AVFVRYNHKT DAALWHRSNH
60 70 80 90 100
SNADNEFYFR YPSFQDVHAM VFVGFGFLMV FLQRYGFSSV GFTFLLAAFA
110 120 130 140 150
LQWSTLVQGF LHSFHGGHIH VGVESMINAD FCAGAVLISF GAVLGKTGPT
160 170 180 190 200
QLLLMALLEV VLFGINEFVL LHLLGVRDAG GSMTIHTFGA YFGLVLSRVL
210 220 230 240 250
YRPQLEKSKH RQGSVYHSDL FAMIGTIFLW IFWPSFNAAL TALGAGQHRT
260 270 280 290 300
ALNTYYSLAA STLGTFALSA LVGEDGRLDM VHIQNAALAG GVVVGTSSEM
310 320 330 340 350
MLTPFGALAA GFLAGTVSTL GYKFFTPILE SKFKVQDTCG VHNLHGMPGV
360 370 380 390 400
LGALLGVLVA GLATHEAYGD GLESVFPLIA EGQRSATSQA MHQLFGLFVT
410 420 430 440
LMFASVGGGL GGLLLKLPFL DSPPRLPALR GPSSLAGAWR A
Length:441
Mass (Da):47,231
Last modified:October 14, 2008 - v2
Checksum:i21EE1FE592F2E1EE
GO
Isoform 2 (identifier: Q9H310-2) [UniParc]FASTAAdd to basket
Also known as: RhBG-2A

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: Missing.
     31-63: AVFVRYNHKTDAALWHRSNHSNADNEFYFRYPS → MNFTFATQKSLTLLPRLECNGAISAHCNLHLPG

Note: No experimental confirmation available.
Show »
Length:411
Mass (Da):43,675
Checksum:iB9C06223F4445B97
GO
Isoform 3 (identifier: Q9H310-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: Missing.
     175-175: G → GVRVWGGMESGVGGGQGQPLSQERGGGGGVLPLTPPPQ

Note: No experimental confirmation available.
Show »
Length:409
Mass (Da):42,978
Checksum:iD0FE23FCAC1344ED
GO
Isoform 4 (identifier: Q9H310-4) [UniParc]FASTAAdd to basket
Also known as: RhBG-1A

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: Missing.

Show »
Length:372
Mass (Da):39,396
Checksum:i47C840C8A19763F5
GO
Isoform 5 (identifier: Q9H310-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: Missing.
     372-441: Missing.

Show »
Length:302
Mass (Da):32,092
Checksum:iB758ABDDBA1E2E90
GO

Sequence cautioni

The sequence AAG01086 differs from that shown. Reason: Frameshift at position 425.Curated
The sequence AAL05978 differs from that shown. Reason: Frameshift at position 425.Curated
The sequence AAN34363 differs from that shown. Reason: Frameshift at position 425.Curated
The sequence AAN34364 differs from that shown. Reason: Frameshift at position 425.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03149776G → D.2 PublicationsCorresponds to variant rs2245623dbSNPEnsembl.1
Natural variantiVAR_031498143V → D.1 PublicationCorresponds to variant rs11586833dbSNPEnsembl.1
Natural variantiVAR_031499315G → R.1 PublicationCorresponds to variant rs3748569dbSNPEnsembl.1
Natural variantiVAR_053637339C → R.Corresponds to variant rs3748567dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0243401 – 69Missing in isoform 3, isoform 4 and isoform 5. 3 PublicationsAdd BLAST69
Alternative sequenceiVSP_0243411 – 30Missing in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_02434231 – 63AVFVR…FRYPS → MNFTFATQKSLTLLPRLECN GAISAHCNLHLPG in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_024343175G → GVRVWGGMESGVGGGQGQPL SQERGGGGGVLPLTPPPQ in isoform 3. 1 Publication1
Alternative sequenceiVSP_037136372 – 441Missing in isoform 5. 1 PublicationAdd BLAST70

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF193807 mRNA. Translation: AAG01086.1. Frameshift.
AF219980
, AF219977, AF219978, AF219979 Genomic DNA. Translation: AAL05978.1. Frameshift.
AY139092 mRNA. Translation: AAN34363.1. Frameshift.
AY139093 mRNA. Translation: AAN34364.1. Frameshift.
AK054780 mRNA. Translation: BAG51423.1.
AK290840 mRNA. Translation: BAF83529.1.
AL589685, AL139130 Genomic DNA. Translation: CAI14175.1.
AL589685, AL139130 Genomic DNA. Translation: CAI14176.1.
AL589685, AL139130 Genomic DNA. Translation: CAI14177.1.
AL139130, AL589685 Genomic DNA. Translation: CAI12178.1.
AL139130, AL589685 Genomic DNA. Translation: CAI12179.1.
AL139130, AL589685 Genomic DNA. Translation: CAI12180.1.
CH471121 Genomic DNA. Translation: EAW52961.1.
BC065218 mRNA. Translation: AAH65218.1.
RefSeqiNP_001243324.1. NM_001256395.1.
NP_001243325.1. NM_001256396.1.
NP_065140.3. NM_020407.4.
UniGeneiHs.131835.

Genome annotation databases

EnsembliENST00000537040; ENSP00000441197; ENSG00000132677.
GeneIDi57127.
KEGGihsa:57127.
UCSCiuc031vbi.2. human. [Q9H310-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF193807 mRNA. Translation: AAG01086.1. Frameshift.
AF219980
, AF219977, AF219978, AF219979 Genomic DNA. Translation: AAL05978.1. Frameshift.
AY139092 mRNA. Translation: AAN34363.1. Frameshift.
AY139093 mRNA. Translation: AAN34364.1. Frameshift.
AK054780 mRNA. Translation: BAG51423.1.
AK290840 mRNA. Translation: BAF83529.1.
AL589685, AL139130 Genomic DNA. Translation: CAI14175.1.
AL589685, AL139130 Genomic DNA. Translation: CAI14176.1.
AL589685, AL139130 Genomic DNA. Translation: CAI14177.1.
AL139130, AL589685 Genomic DNA. Translation: CAI12178.1.
AL139130, AL589685 Genomic DNA. Translation: CAI12179.1.
AL139130, AL589685 Genomic DNA. Translation: CAI12180.1.
CH471121 Genomic DNA. Translation: EAW52961.1.
BC065218 mRNA. Translation: AAH65218.1.
RefSeqiNP_001243324.1. NM_001256395.1.
NP_001243325.1. NM_001256396.1.
NP_065140.3. NM_020407.4.
UniGeneiHs.131835.

3D structure databases

ProteinModelPortaliQ9H310.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121390. 1 interactor.
IntActiQ9H310. 2 interactors.
STRINGi9606.ENSP00000357229.

Protein family/group databases

TCDBi1.A.11.4.2. the ammonium transporter channel (amt) family.

PTM databases

PhosphoSitePlusiQ9H310.

Polymorphism and mutation databases

BioMutaiRHBG.
DMDMi209572666.

Proteomic databases

PaxDbiQ9H310.
PRIDEiQ9H310.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000537040; ENSP00000441197; ENSG00000132677.
GeneIDi57127.
KEGGihsa:57127.
UCSCiuc031vbi.2. human. [Q9H310-1]

Organism-specific databases

CTDi57127.
GeneCardsiRHBG.
HGNCiHGNC:14572. RHBG.
HPAiHPA042726.
HPA048489.
MIMi607079. gene.
neXtProtiNX_Q9H310.
PharmGKBiPA34385.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3796. Eukaryota.
ENOG410XTF8. LUCA.
HOVERGENiHBG004374.
InParanoidiQ9H310.
KOiK06580.
OrthoDBiEOG091G06KX.
PhylomeDBiQ9H310.
TreeFamiTF314450.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000132677-MONOMER.
ReactomeiR-HSA-444411. Rhesus glycoproteins mediate ammonium transport.

Miscellaneous databases

GeneWikiiRHBG.
GenomeRNAii57127.
PROiQ9H310.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000132677.
ExpressionAtlasiQ9H310. baseline and differential.
GenevisibleiQ9H310. HS.

Family and domain databases

Gene3Di1.10.3430.10. 1 hit.
InterProiIPR029020. Ammonium/urea_transptr.
IPR001905. Ammonium_transpt.
IPR024041. NH4_transpt_AmtB-like_dom.
IPR002229. RhesusRHD.
[Graphical view]
PANTHERiPTHR11730. PTHR11730. 1 hit.
PfamiPF00909. Ammonium_transp. 1 hit.
[Graphical view]
PRINTSiPR00342. RHESUSRHD.
SUPFAMiSSF111352. SSF111352. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiRHBG_HUMAN
AccessioniPrimary (citable) accession number: Q9H310
Secondary accession number(s): A8K475
, Q5SZW4, Q5SZW6, Q5SZW7, Q6P193, Q6YJI2, Q6YJI3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: October 14, 2008
Last modified: November 30, 2016
This is version 115 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.