Q9H2X9 (S12A5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 94.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Solute carrier family 12 member 5 Alternative name(s): Electroneutral potassium-chloride cotransporter 2 K-Cl cotransporter 2 Short name=hKCC2 Neuronal K-Cl cotransporter | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1139 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Mediates electroneutral potassium-chloride cotransport in mature neurons. Transport occurs under isotonic conditions, but is activated 20-fold by cell swelling. Important for Cl- homeostasis in neurons. |
| Enzyme regulation | Inhibited by WNK3. Ref.6 |
| Subunit structure | Homomultimer and heteromultimer with other K-Cl cotransporters. Interacts with AP2A1 By similarity. |
| Subcellular location | |
| Tissue specificity | Brain specific. Detected in neuronal cells. |
| Miscellaneous | Inhibited by furosemide and bumetanide. |
| Sequence similarities | Belongs to the SLC12A transporter family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ion transport Potassium transport Symport Transport |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Ligand | Potassium |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | potassium ion transport Inferred from electronic annotation. Source: UniProtKB-KW sodium ion transportInferred from electronic annotation. Source: InterPro |
| Cellular component | integral to membrane Non-traceable author statement Ref.1. Source: UniProtKB |
| Molecular function | potassium:chloride symporter activity Non-traceable author statement Ref.1. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||||
| Isoform 1 (identifier: Q9H2X9-1) Also known as: KCC2a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||||
| Isoform 2 (identifier: Q9H2X9-2) Also known as: KCC2b; The sequence of this isoform differs from the canonical sequence as follows: 1-40: MSRRFTVTSLPPAGPARSPDPESRRHSVADPRHLPGEDVK → MLNNLTDCEDGDGGANP | ||||||||
Sequence annotation (Features) | ||||||||
|---|---|---|---|---|---|---|---|---|
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||
| Sequence conflict | 2 | 1 | L → P in AAG43493. Ref.1 | |||||
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1139 | 1139 | Solute carrier family 12 member 5 | PRO_0000178034 | |||||
Regions | |||||||||
| Topological domain | 1 – 133 | 133 | Cytoplasmic Potential | ||||||
| Transmembrane | 134 – 154 | 21 | Helical; Potential | ||||||
| Transmembrane | 156 – 176 | 21 | Helical; Potential | ||||||
| Topological domain | 177 – 194 | 18 | Cytoplasmic Potential | ||||||
| Transmembrane | 195 – 215 | 21 | Helical; Potential | ||||||
| Transmembrane | 217 – 237 | 21 | Helical; Potential | ||||||
| Topological domain | 238 – 254 | 17 | Cytoplasmic Potential | ||||||
| Transmembrane | 255 – 275 | 21 | Helical; Potential | ||||||
| Transmembrane | 278 – 298 | 21 | Helical; Potential | ||||||
| Topological domain | 299 – 418 | 120 | Cytoplasmic Potential | ||||||
| Transmembrane | 419 – 439 | 21 | Helical; Potential | ||||||
| Transmembrane | 459 – 479 | 21 | Helical; Potential | ||||||
| Topological domain | 480 – 496 | 17 | Cytoplasmic Potential | ||||||
| Transmembrane | 497 – 517 | 21 | Helical; Potential | ||||||
| Transmembrane | 570 – 590 | 21 | Helical; Potential | ||||||
| Topological domain | 591 – 630 | 40 | Cytoplasmic Potential | ||||||
| Transmembrane | 631 – 651 | 21 | Helical; Potential | ||||||
| Transmembrane | 848 – 868 | 21 | Helical; Potential | ||||||
| Topological domain | 869 – 1139 | 271 | Cytoplasmic Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 442 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 833 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 40 | 40 | MSRRF…GEDVK → MLNNLTDCEDGDGGANP in isoform 2. | VSP_029909 | |||||
| Natural variant | 407 | 1 | P → A. Corresponds to variant rs16985442 [ dbSNP | Ensembl ]. | VAR_027414 | |||||
| Natural variant | 847 | 1 | G → D in a colorectal cancer sample; somatic mutation. Ref.7 | VAR_036557 | |||||
| Natural variant | 1100 | 1 | P → L. Ref.5 Corresponds to variant rs17297532 [ dbSNP | Ensembl ]. | VAR_024994 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular, functional, and genomic characterization of human KCC2, the neuronal K-Cl cotransporter." Song L., Mercado A., Vazquez N., Xie Q., Desai R., George A.L. Jr., Gamba G., Mount D.B. Brain Res. Mol. Brain Res. 103:91-105(2002) [PubMed: 12106695] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Brain. |
| [2] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed: 11780052] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [4] | "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." Kimura K., Wakamatsu A., Suzuki Y., Ota T., Nishikawa T., Yamashita R., Yamamoto J., Sekine M., Tsuritani K., Wakaguri H., Ishii S., Sugiyama T., Saito K., Isono Y., Irie R., Kushida N., Yoneyama T., Otsuka R. Sugano S.Genome Res. 16:55-65(2006) [PubMed: 16344560] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-175 (ISOFORM 1). |
| [5] | "Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain." Hirosawa M., Nagase T., Ishikawa K., Kikuno R., Nomura N., Ohara O. DNA Res. 6:329-336(1999) [PubMed: 10574461] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 9-1109 (ISOFORM 2), VARIANT LEU-1100. Tissue: Brain. |
| [6] | "Similar Effects of all WNK3 Variants upon SLC12 Cotransporters." Cruz-Rangel S., Melo Z., Vazquez N., Meade P., Bobadilla N.A., Pasantes-Morales H., Gamba G., Mercado A. Am. J. Physiol. 301:C601-C608(2011) [PubMed: 21613606] [Abstract] Cited for: ENZYME REGULATION. |
| [7] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] ASP-847. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF208159 mRNA. Translation: AAG43493.1. AL162458 Genomic DNA. Translation: CAH74054.2. BC132668 mRNA. Translation: AAI32669.1. BC132670 mRNA. Translation: AAI32671.1. AB033002 mRNA. Translation: BAA86490.1. DA102113 mRNA. No translation available. DA328785 mRNA. No translation available. |
| IPI | IPI00301180. IPI00877110. |
| RefSeq | NP_001128243.1. NM_001134771.1. NP_065759.1. NM_020708.4. |
| UniGene | Hs.21413. |
3D structure databases | |
| ProteinModelPortal | Q9H2X9. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9H2X9. |
PTM databases | |
| PhosphoSite | Q9H2X9. |
Polymorphism databases | |
| DMDM | 161784306. |
Proteomic databases | |
| PRIDE | Q9H2X9. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000454036; ENSP00000387694; ENSG00000124140. |
| GeneID | 57468. |
| KEGG | hsa:57468. |
| UCSC | uc002xrb.1. human. |
Organism-specific databases | |
| CTD | 57468. |
| GeneCards | GC20P044651. |
| HGNC | HGNC:13818. SLC12A5. |
| HPA | HPA004942. |
| MIM | 606726. gene. |
| neXtProt | NX_Q9H2X9. |
| PharmGKB | PA37814. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG05818. |
| GeneTree | ENSGT00560000076892. |
| HOGENOM | HBG590211. |
| HOVERGEN | HBG052852. |
| InParanoid | Q9H2X9. |
| OMA | TWRNFIE. |
| PhylomeDB | Q9H2X9. |
Enzyme and pathway databases | |
| Reactome | REACT_15518. Transmembrane transport of small molecules. |
Gene expression databases | |
| ArrayExpress | Q9H2X9. |
| Bgee | Q9H2X9. |
| CleanEx | HS_SLC12A5. |
| Genevestigator | Q9H2X9. |
| GermOnline | ENSG00000124140. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR004841. AA-permease_dom. IPR000076. KCL_cotranspt. IPR004842. Na/K/Cl_cotransptS. [Graphical view] |
| KO | K14427. |
| Pfam | PF00324. AA_permease. 2 hits. [Graphical view] |
| PRINTS | PR01081. KCLTRNSPORT. |
| TIGRFAMs | TIGR00930. 2a30. 1 hit. |
| ProtoNet | Search... |
Other | |
| DrugBank | DB00887. Bumetanide. DB00761. Potassium Chloride. |
| NextBio | 63686. |
| SOURCE | Search... |
Entry information
| Entry name | S12A5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H2X9 Secondary accession number(s): A2RTX2 Q9ULP4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with