Reviewed,
UniProtKB/Swiss-Prot Q9H2X6 (HIPK2_HUMAN)
Last modified
June 16, 2009.
Version 89.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Homeodomain-interacting protein kinase 2 Short name=hHIPk2 EC=2.7.11.1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1198 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Protein kinase acting as a corepressor of several transcription factors, including SMAD1 and POU4F1/Brn3a and probably NK homeodomain transcription factors. Inhibits cell growth and promotes apoptosis. Involved in transcriptional activation of TP53 and TP73. Phosphorylation of TP53 may be mediated by a TP53-HIPK2-AXIN1 complex. In response to TGFB, cooperates with DAXX to activate JNK. Phosphorylates the antiapoptotic factor CTBP1 and promotes its proteasomal degradation. In the Wnt/beta-catenin signaling pathway acts as an intermediate kinase between TAK1 and NLK to promote the proteasomal degradation of MYB By similarity. Phosphorylates CBX4 upon DNA damage and promotes its E3 SUMO-protein ligase activity. |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Subunit structure | Interacts with TRADD, TP53, TP73, TP63, CREBBP, DAXX, P53DINP1, SKI, SMAD1, SMAD2 and SMAD3, but not SMAD4. Interacts with NKX1-2, NKX2-5, SPN/CD43, UBE2I, HMGA1, CTBP1, AXIN1, NLK, MYB, POU4F1, POU4F2, POU4F3, UBE2I, UBL1. Probably part of a complex consisting of TP53, HIPK2 and AXIN1 By similarity. Interacts with CBX4. |
| Subcellular location | Nucleus. Cytoplasm. Note: Concentrated in PML/POD/ND10 nuclear bodies. Small amounts are cytoplasmic. Ref.1 Ref.7 Ref.9 Ref.10 Ref.12 |
| Tissue specificity | Highly expressed in heart, muscle and kidney. Weakly expressed in a ubiquitous way. Down-regulated in several thyroid and breast tumors. Ref.1 Ref.6 |
| Induction | By UV. Ref.9 |
| Post-translational modification | Phosphorylated on tyrosines By similarity. Autophosphorylated. Sumoylated. When conjugated it is directed to nuclear speckles. Desumoylated by SENP1 By similarity. Sumoylation on Lys-32 is promoted by the E3 SUMO-protein ligase CBX4. |
| Sequence similarities | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily. Contains 1 protein kinase domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| BAT1 | Q13838 | 1 | EBI-348345,EBI-348622 | |
| HMGA1 | P17096-1 | 1 | EBI-348345,EBI-746854 | |
| HMGA1 | P17096-2 | 1 | EBI-348345,EBI-746858 | |
| MYB | P10242 | 1 | EBI-348345,EBI-298355 | |
| WSB1 | Q9Y6I7 | 1 | EBI-348345,EBI-1171494 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform 1 (identifier: Q9H2X6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9H2X6-2) The sequence of this isoform differs from the canonical sequence as follows: 808-907: Missing. 989-1018: VNTSHHSSSYKSKSSSNVTSTSGHSSGSSS → GNLGPGQGRNLSLESGFPAFLLLEMLLYGS 1019-1198: Missing. | ||||||
| Isoform 3 (identifier: Q9H2X6-3) The sequence of this isoform differs from the canonical sequence as follows: 595-621: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1198 | 1198 | Homeodomain-interacting protein kinase 2 | PRO_0000085995 | |||||
Regions | |||||||||
| Domain | 199 – 527 | 329 | Protein kinase | ||||||
| Nucleotide binding | 205 – 213 | 9 | ATP Probable | ||||||
| Region | 97 – 230 | 134 | Transcriptional corepression By similarity | ||||||
| Region | 189 – 520 | 332 | Interaction with DAXX | ||||||
| Region | 539 – 844 | 306 | Interaction with SKI and SMAD1 | ||||||
| Region | 752 – 897 | 146 | Interaction with POU4F1 By similarity | ||||||
| Region | 774 – 876 | 103 | Interaction with CTBP1 By similarity | ||||||
| Region | 787 – 897 | 111 | Interaction with HMGA1 By similarity | ||||||
| Region | 846 – 941 | 96 | Interaction with TP53 and TP73 | ||||||
| Region | 873 – 980 | 108 | Required for localization to nuclear speckles By similarity | ||||||
| Region | 873 – 907 | 35 | Interaction with UBE2I By similarity | ||||||
| Region | 935 – 1049 | 115 | Interaction with AXIN1 By similarity | ||||||
| Compositional bias | 1088 – 1094 | 7 | Poly-Ala | ||||||
Sites | |||||||||
| Active site | 324 | 1 | Proton acceptor Probable | ||||||
| Binding site | 228 | 1 | ATP Probable | ||||||
Amino acid modifications | |||||||||
| Modified residue | 361 | 1 | Phosphotyrosine Ref.16 | ||||||
| Cross-link | 32 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) Ref.15 | |||||||
| Cross-link | 1191 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) By similarity | |||||||
Natural variations | |||||||||
| Alternative sequence | 595 – 621 | 27 | Missing in isoform 3. | VSP_004804 | |||||
| Alternative sequence | 808 – 907 | 100 | Missing in isoform 2. | VSP_004805 | |||||
| Alternative sequence | 989 – 1018 | 30 | VNTSH…SGSSS → GNLGPGQGRNLSLESGFPAF LLLEMLLYGS in isoform 2. | VSP_004806 | |||||
| Alternative sequence | 1019 – 1198 | 180 | Missing in isoform 2. | VSP_004807 | |||||
| Natural variant | 792 | 1 | R → Q Ref.17 | VAR_040547 | |||||
| Natural variant | 1027 | 1 | R → Q Ref.17 | VAR_040548 | |||||
Experimental info | |||||||||
| Mutagenesis | 228 | 1 | K → A: Locates in the nucleoplasm, no effect on interaction with RANBP9. Ref.1 Ref.7 Ref.9 Ref.10 Ref.8 Ref.11 Ref.13 | ||||||
| Mutagenesis | 228 | 1 | K → R: Abolishes enzymatic activity, no effect on interaction with TP53 and TP73 or on BMP-induced transcriptional activation. Enhances BMP-induced transcriptional activation; when associated with 359-AAF-361. Ref.1 Ref.7 Ref.9 Ref.10 Ref.8 Ref.11 Ref.13 | ||||||
| Mutagenesis | 359 – 361 | 3 | STY → AAF: Enhances BMP-induced transcriptional activation; when associated with R-228. Ref.13 | ||||||
| Sequence conflict | 33 | 1 | I → V in AAG41236. Ref.1 | ||||||
| Sequence conflict | 59 | 1 | L → P in AAG41236. Ref.1 | ||||||
| Sequence conflict | 64 | 1 | T → S in AAG41236. Ref.1 | ||||||
| Sequence conflict | 169 | 1 | S → F in AAG35710. Ref.4 | ||||||
| Sequence conflict | 187 | 1 | V → S in AAG35710. Ref.4 | ||||||
| Sequence conflict | 202 | 1 | L → S in AAG35710. Ref.4 | ||||||
| Sequence conflict | 233 | 1 | H → R in AAG41236. Ref.1 | ||||||
| Sequence conflict | 471 | 1 | N → I in AAL37371. Ref.2 | ||||||
| Sequence conflict | 669 | 1 | P → S in AAG35710. Ref.4 | ||||||
| Sequence conflict | 711 | 1 | T → N in AAG35710. Ref.4 | ||||||
| Sequence conflict | 717 – 719 | 3 | PPA → SPT in AAG35710. Ref.4 | ||||||
| Sequence conflict | 724 | 1 | T → D in AAG35710. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and characterization of cDNAs for the protein kinase HIPK2." Wang Y., Hofmann T.G., Runkel L., Haaf T., Schaller H., Debatin K.-M., Hug H. Biochim. Biophys. Acta 1518:168-172(2001) [PubMed: 11267674] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, MUTAGENESIS OF LYS-228. Tissue: Liver and Testis. |
| [2] | "Sequencing of hHIPk2, a human homolog of mouse homeodomain interacting protein kinase 2." Stukart G.C., Dias-Neto E. Submitted (DEC-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). Tissue: Frontal cortex. |
| [3] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed: 12853948] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Pierantoni G.M., Benvenuto G., Chiariotti L., Fusco A. Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 8-1198 (ISOFORM 2). |
| [5] | "The serine/threonine kinase HIPK2 interacts with TRADD, but not with CD95 or TNF-R1 in 293T cells." Li X., Wang Y., Debatin K.-M., Hug H. Biochem. Biophys. Res. Commun. 277:513-517(2000) [PubMed: 11032752] [Abstract] Cited for: INTERACTION WITH TRADD. |
| [6] | "The homeodomain-interacting protein kinase 2 gene is expressed late in embryogenesis and preferentially in retina, muscle, and neural tissues." Pierantoni G.M., Bulfone A., Pentimalli F., Fedele M., Iuliano R., Santoro M., Chiariotti L., Ballabio A., Fusco A. Biochem. Biophys. Res. Commun. 290:942-947(2002) [PubMed: 11798164] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [7] | "HIPK2 associates with RanBPM." Wang Y., Marion Schneider E., Li X., Duttenhoefer I., Debatin K.-M., Hug H. Biochem. Biophys. Res. Commun. 297:148-153(2002) [PubMed: 12220523] [Abstract] Cited for: INTERACTION WITH RANBP9, SUBCELLULAR LOCATION, MUTAGENESIS OF LYS-228. |
| [8] | "Identification and characterization of HIPK2 interacting with p73 and modulating functions of the p53 family in vivo." Kim E.-J., Park J.-S., Um S.-J. J. Biol. Chem. 277:32020-32028(2002) [PubMed: 11925430] [Abstract] Cited for: INTERACTION WITH TP73; TP53 AND TP63, MUTAGENESIS OF LYS-228, FUNCTION. |
| [9] | "Regulation of p53 activity by its interaction with homeodomain-interacting protein kinase-2." Hofmann T.G., Moeller A., Sirma H., Zentgraf H., Taya Y., Droege W., Will H., Schmitz M.L. Nat. Cell Biol. 4:1-10(2002) [PubMed: 11740489] [Abstract] Cited for: SUBCELLULAR LOCATION, AUTOPHOSPHORYLATION, INTERACTION WITH TP53 AND CREBBP, MUTAGENESIS OF LYS-228, FUNCTION, INDUCTION. |
| [10] | "PML is required for homeodomain-interacting protein kinase 2 (HIPK2)-mediated p53 phosphorylation and cell cycle arrest but is dispensable for the formation of HIPK domains." Moeller A., Sirma H., Hofmann T.G., Rueffer S., Klimczak E., Droege W., Will H., Schmitz M.L. Cancer Res. 63:4310-4314(2003) [PubMed: 12907596] [Abstract] Cited for: SUBCELLULAR LOCATION, MUTAGENESIS OF LYS-228. |
| [11] | "HIPK2 regulates transforming growth factor-beta-induced c-Jun NH(2)-terminal kinase activation and apoptosis in human hepatoma cells." Hofmann T.G., Stollberg N., Schmitz M.L., Will H. Cancer Res. 63:8271-8277(2003) [PubMed: 14678985] [Abstract] Cited for: FUNCTION, INTERACTION WITH DAXX, MUTAGENESIS OF LYS-228. |
| [12] | "TP53INP1s and homeodomain-interacting protein kinase-2 (HIPK2) are partners in regulating p53 activity." Tomasini R., Samir A.A., Carrier A., Isnardon D., Cecchinelli B., Soddu S., Malissen B., Dagorn J.-C., Iovanna J.L., Dusetti N.J. J. Biol. Chem. 278:37722-37729(2003) [PubMed: 12851404] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH P53DINP1. |
| [13] | "Requirement of the co-repressor homeodomain-interacting protein kinase 2 for ski-mediated inhibition of bone morphogenetic protein-induced transcriptional activation." Harada J., Kokura K., Kanei-Ishii C., Nomura T., Khan M.M., Kim Y., Ishii S. J. Biol. Chem. 278:38998-39005(2003) [PubMed: 12874272] [Abstract] Cited for: FUNCTION, INTERACTION WITH SKI; SMAD1; SMAD2 AND SMAD3, MUTAGENESIS OF LYS-228 AND 359-SER--TYR-361. |
| [14] | "Desumoylation of homeodomain-interacting protein kinase 2 (HIPK2) through the cytoplasmic-nuclear shuttling of the SUMO-specific protease SENP1." Kim Y.H., Sung K.S., Lee S.-J., Kim Y.-O., Choi C.Y., Kim Y. FEBS Lett. 579:6272-6278(2005) [PubMed: 16253240] [Abstract] Cited for: DESUMOYLATION. |
| [15] | "Phosphorylation-dependent control of Pc2 SUMO E3 ligase activity by its substrate protein HIPK2." Roscic A., Moeller A., Calzado M.A., Renner F., Wimmer V.C., Gresko E., Luedi K.S., Schmitz M.L. Mol. Cell 24:77-89(2006) [PubMed: 17018294] [Abstract] Cited for: INTERACTION WITH CBX4, SUMOYLATION AT LYS-32, FUNCTION. |
| [16] | "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer." Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J., Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L., Mitchell J., Wetzel R., Macneill J., Ren J.M. Comb M.J.Cell 131:1190-1203(2007) [PubMed: 18083107] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-361, MASS SPECTROMETRY. |
| [17] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed: 17344846] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] GLN-792 AND GLN-1027. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF208291 mRNA. Translation: AAG41236.1. AF326592 mRNA. Translation: AAL37371.1. AC005531 Genomic DNA. Translation: AAS00368.1. AC073184 Genomic DNA. No translation available. AC006021 Genomic DNA. No translation available. AC141932 Genomic DNA. No translation available. AF207702 mRNA. Translation: AAG35710.1. | |
| IPI | IPI00215949. IPI00215950. IPI00289892. |
| RefSeq | NP_001106710.1. NP_073577.3. |
| UniGene | Hs.397465 Hs.632033 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1H0V based on UniProtKB P24941. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9H2X6. 5 interactions. |
PTM databases | |
| PhosphoSite | Q9H2X6. |
Proteomic databases | |
| PRIDE | Q9H2X6. |
Genome annotation databases | |
| Ensembl | ENSG00000064393. Homo sapiens. [Contig view] |
| GeneID | 28996. |
| KEGG | hsa:28996. |
Organism-specific databases | |
| GeneCards | GC07M138907. GC07M138908. |
| H-InvDB | HIX0007135. HIX0033770. |
| HGNC | HGNC:14402. HIPK2. |
| MIM | 606868. gene. |
| PharmGKB | PA29291. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | Q9H2X6. |
| HOVERGEN | Q9H2X6. |
Enzyme and pathway databases | |
| BRENDA | 2.7.11.1. 247. |
Gene expression databases | |
| ArrayExpress | Q9H2X6. |
| Bgee | Q9H2X6. |
| CleanEx | HS_HIPK2. |
| GermOnline | ENSG00000064393. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000719. Prot_kinase_core. IPR017441. Protein_kinase_ATP_BS. IPR017442. Se/Thr_pkinase-rel. IPR008271. Ser_thr_pkin_AS. IPR002290. Ser_thr_pkinase. [Graphical view] |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| ProDom | PD000001. Prot_kinase. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 51926. |
| PMAP-CutDB | Q9H2X6. |
| SOURCE | Search... |
Entry information
| Entry name | HIPK2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H2X6 Secondary accession number(s): Q75MR7, Q8WWI4, Q9H2Y1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| SIMILARITY comments Index of protein domains and families |

Clusters with


