Q9H2X6 (HIPK2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 133.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Homeodomain-interacting protein kinase 2 Short name=hHIPk2 EC=2.7.11.1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1198 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Serine/threonine-protein kinase involved in transcription regulation, p53/TP53-mediated cellular apoptosis and regulation of the cell cycle. Acts as a corepressor of several transcription factors, including SMAD1 and POU4F1/Brn3a and probably NK homeodomain transcription factors. Phosphorylates PDX1, ATF1, PML, p53/TP53, CREB1, CTBP1, CBX4, RUNX1, EP300, CTNNB1, HMGA1 and ZBTB4. Inhibits cell growth and promotes apoptosis through the activation of p53/TP53 both at the transcription level and at the protein level (by phosphorylation and indirect acetylation). The phosphorylation of p53/TP53 may be mediated by a p53/TP53-HIPK2-AXIN1 complex. Involved in the response to hypoxia by acting as a transcriptional co-suppressor of HIF1A. Mediates transcriptional activation of TP73. In response to TGFB, cooperates with DAXX to activate JNK. Negative regulator through phosphorylation and subsequent proteasomal degradation of CTNNB1 and the antiapoptotic factor CTBP1. In the Wnt/beta-catenin signaling pathway acts as an intermediate kinase between MAP3K7/TAK1 and NLK to promote the proteasomal degradation of MYB. Phosphorylates CBX4 upon DNA damage and promotes its E3 SUMO-protein ligase activity. Activates CREB1 and ATF1 transcription factors by phosphorylation in response to genotoxic stress. In response to DNA damage, stabilizes PML by phosphorylation. PML, HIPK2 and FBXO3 may act synergically to activate p53/TP53-dependent transactivation. Promotes angiogenesis, and is involved in erythroid differentiation, especially during fetal liver erythropoiesis. Phosphorylation of RUNX1 and EP300 stimulates EP300 transcription regulation activity. Triggers ZBTB4 protein degradation in response to DNA damage. Modulates HMGA1 DNA-binding affinity. In response to high glucose, triggers phosphorylation-mediated subnuclear localization shifting of PDX1. Involved in the regulation of eye size, lens formation and retinal lamination during late embryogenesis. Ref.8 Ref.9 Ref.11 Ref.12 Ref.13 Ref.16 Ref.17 Ref.18 Ref.20 Ref.22 Ref.24 Ref.25 Ref.27 Ref.28 Ref.29 Ref.30 Ref.32 Ref.37 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Subunit structure | Interacts with CREB1, SIAH1, WSB1, CBX4, TRADD, p53/TP53, TP73, TP63, CREBBP, DAXX, P53DINP1, SKI, SMAD1, SMAD2 and SMAD3, but not SMAD4. Interacts with ATF1, PML, RUNX1, EP300, NKX1-2, NKX2-5, SPN/CD43, UBE2I, HMGA1, CTBP1, AXIN1, NLK, MYB, POU4F1, POU4F2, POU4F3, UBE2I, UBL1 and ZBTB4. Probably part of a complex consisting of p53/TP53, HIPK2 and AXIN1. Ref.5 Ref.7 Ref.8 Ref.9 Ref.11 Ref.12 Ref.13 Ref.16 Ref.19 Ref.21 Ref.24 Ref.25 Ref.29 Ref.30 Ref.31 |
| Subcellular location | Nucleus › PML body. Cytoplasm. Note: Concentrated in PML/POD/ND10 nuclear bodies. Small amounts are cytoplasmic. Ref.1 Ref.7 Ref.9 Ref.10 Ref.12 Ref.31 Ref.32 |
| Tissue specificity | Highly expressed in heart, muscle and kidney. Weakly expressed in a ubiquitous way. Down-regulated in several thyroid and breast tumors. Ref.1 Ref.6 |
| Induction | Unstable in unstressed cells but stabilized upon DNA damage. Induced by UV irradiation and other genotoxic agents (adriamycin ADR, cisplatin CDDP, etoposide, IR, roscovitin), thus triggering p53/TP53 apoptotic response. Consistutively negatively regulated by SIAH1 and WSB1 through proteasomal degradation. This negative regulation is impaired upon genotoxic stress. Repressed upon hypoxia (often associated with tumors), through MDM2- (an E3 ubiquitin ligases) mediated proteasomal degradation, thus inactivating p53/TP53 apoptotic response. This hypoxia repression is reversed by zinc. The stabilization mediated by DNA damage requires the damage checkpoint kinases ATM and ATR. Ref.9 Ref.21 Ref.26 Ref.33 Ref.36 |
| Post-translational modification | Phosphorylated on tyrosines By similarity. Autophosphorylated. Ref.9 Sumoylated. When conjugated it is directed to nuclear speckles. Desumoylated by SENP1 By similarity. Sumoylation on Lys-32 is promoted by the E3 SUMO-protein ligase CBX4. Ref.14 Ref.16 Ref.31 Ref.32 Ubiquitinated by FBXO3, WSB1 and SIAH1, leading to rapid proteasome-dependent degradation. The degradation mediated by FBXO3, but not ubiquitination, is prevented in the presence of PML. The degradation mediated by WSB1 and SIAH1 is reversibly reduced upon DNA damage. Ref.19 Ref.20 Ref.21 Cleaved at Asp-923 and Asp-984 by CASP6 in a p53/TP53-dependent manner. The cleaved form lacks the autoinhibitory C-terminal domain (AID), resulting in a hyperactive kinase, which potentiates p53/TP53 Ser-46 phosphorylation and subsequent activation of the cell death machinery. Ref.15 |
| Miscellaneous | Interesting targets for cancer therapy. HIPK2 deregulation would end up in a multifactorial response leading to tumor chemoresistance by affecting p53/TP53 activity on one hand and to angiogenesis and cell proliferation by affecting HIF1A activity on the other hand. May provide important insights in the process of tumor progression, and may also serve as the crucial point in the diagnostic and therapeutical aspects of cancer. Tumor treatment may potential be improved by zinc supplementation in combination with chemotherapy to address hypoxia (Ref.36). |
| Sequence similarities | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily. Contains 1 protein kinase domain. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform 1 (identifier: Q9H2X6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9H2X6-2) The sequence of this isoform differs from the canonical sequence as follows: 808-907: Missing. 989-1018: VNTSHHSSSYKSKSSSNVTSTSGHSSGSSS → GNLGPGQGRNLSLESGFPAFLLLEMLLYGS 1019-1198: Missing. | ||||||
| Isoform 3 (identifier: Q9H2X6-3) The sequence of this isoform differs from the canonical sequence as follows: 595-621: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1198 | 1198 | Homeodomain-interacting protein kinase 2 | PRO_0000085995 | |||||
Regions | |||||||||
| Domain | 199 – 527 | 329 | Protein kinase | ||||||
| Nucleotide binding | 205 – 213 | 9 | ATP Probable | ||||||
| Region | 97 – 230 | 134 | Transcriptional corepression By similarity | ||||||
| Region | 189 – 520 | 332 | Interaction with DAXX | ||||||
| Region | 539 – 844 | 306 | Interaction with SKI and SMAD1 | ||||||
| Region | 752 – 897 | 146 | Interaction with POU4F1 By similarity | ||||||
| Region | 774 – 876 | 103 | Interaction with CTBP1 By similarity | ||||||
| Region | 787 – 897 | 111 | Interaction with HMGA1 By similarity | ||||||
| Region | 802 – 805 | 4 | Nuclear localization signal 1 (NLS1) | ||||||
| Region | 832 – 835 | 4 | Nuclear localization signal 2 (NLS2) | ||||||
| Region | 846 – 941 | 96 | Interaction with TP53 and TP73 | ||||||
| Region | 873 – 980 | 108 | Required for localization to nuclear speckles By similarity | ||||||
| Region | 873 – 907 | 35 | Interaction with UBE2I By similarity | ||||||
| Region | 884 – 908 | 25 | SUMO interaction motifs (SIM); required for nuclear localization and kinase activity | ||||||
| Region | 935 – 1049 | 115 | Interaction with AXIN1 By similarity | ||||||
| Region | 984 – 1198 | 215 | Autoinhibitory domain (AID) | ||||||
| Compositional bias | 1088 – 1094 | 7 | Poly-Ala | ||||||
Sites | |||||||||
| Active site | 324 | 1 | Proton acceptor Probable | ||||||
| Binding site | 228 | 1 | ATP Probable | ||||||
| Site | 923 – 924 | 2 | Cleavage; by CASP6 | ||||||
| Site | 984 – 985 | 2 | Cleavage; by CASP6 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 361 | 1 | Phosphotyrosine By similarity | ||||||
| Cross-link | 32 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) Ref.16 | |||||||
| Cross-link | 1191 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) By similarity | |||||||
Natural variations | |||||||||
| Alternative sequence | 595 – 621 | 27 | Missing in isoform 3. | VSP_004804 | |||||
| Alternative sequence | 808 – 907 | 100 | Missing in isoform 2. | VSP_004805 | |||||
| Alternative sequence | 989 – 1018 | 30 | VNTSH…SGSSS → GNLGPGQGRNLSLESGFPAF LLLEMLLYGS in isoform 2. | VSP_004806 | |||||
| Alternative sequence | 1019 – 1198 | 180 | Missing in isoform 2. | VSP_004807 | |||||
| Natural variant | 792 | 1 | R → Q. Ref.38 | VAR_040547 | |||||
| Natural variant | 1027 | 1 | R → Q. Ref.38 | VAR_040548 | |||||
Experimental info | |||||||||
| Mutagenesis | 228 | 1 | K → A: Locates in the nucleoplasm, no effect on interaction with RANBP9, but loss of kinase activity toward PML, RUNX1 and EP300. Ref.1 Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 Ref.13 Ref.18 Ref.24 | ||||||
| Mutagenesis | 228 | 1 | K → R: Abolishes enzymatic activity, no effect on interaction with TP53 and TP73 or on BMP-induced transcriptional activation. Enhances BMP-induced transcriptional activation; when associated with 359-AAF-361. Ref.1 Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 Ref.13 Ref.18 Ref.24 | ||||||
| Mutagenesis | 359 – 361 | 3 | STY → AAF: Enhances BMP-induced transcriptional activation; when associated with R-228. Ref.13 | ||||||
| Mutagenesis | 803 | 1 | K → A: Impaired nuclear localization; when associated with A-805. Ref.31 | ||||||
| Mutagenesis | 805 | 1 | K → A: Impaired nuclear localization; when associated with A-803. Ref.31 | ||||||
| Mutagenesis | 833 | 1 | R → A: Impaired nuclear localization. Ref.31 | ||||||
| Mutagenesis | 835 | 1 | K → E: Impaired nuclear localization. Ref.31 | ||||||
| Mutagenesis | 885 – 892 | 8 | VSVITISS → KFMHFHRM: Loss of SUMO and CBX4 interaction, and impaired nuclear and PML-nuclear bodies localization. Ref.31 | ||||||
| Mutagenesis | 885 – 888 | 4 | VSVI → KSAK: Loss of SUMO interaction, and impaired nuclear and PML-nuclear bodies localization. Ref.32 | ||||||
| Mutagenesis | 892 – 895 | 4 | SDTD → ADTA: Loss of SUMO interaction, and impaired nuclear and PML-nuclear bodies localization. Ref.32 | ||||||
| Mutagenesis | 893 – 899 | 7 | DTDEEEE → NFNQQQQ: Loss of SUMO and CBX4 interaction, and impaired nuclear and PML-nuclear bodies localization. Ref.31 | ||||||
| Sequence conflict | 33 | 1 | I → V in AAG41236. Ref.1 | ||||||
| Sequence conflict | 59 | 1 | L → P in AAG41236. Ref.1 | ||||||
| Sequence conflict | 64 | 1 | T → S in AAG41236. Ref.1 | ||||||
| Sequence conflict | 169 | 1 | S → F in AAG35710. Ref.4 | ||||||
| Sequence conflict | 187 | 1 | V → S in AAG35710. Ref.4 | ||||||
| Sequence conflict | 202 | 1 | L → S in AAG35710. Ref.4 | ||||||
| Sequence conflict | 233 | 1 | H → R in AAG41236. Ref.1 | ||||||
| Sequence conflict | 471 | 1 | N → I in AAL37371. Ref.2 | ||||||
| Sequence conflict | 669 | 1 | P → S in AAG35710. Ref.4 | ||||||
| Sequence conflict | 711 | 1 | T → N in AAG35710. Ref.4 | ||||||
| Sequence conflict | 717 – 719 | 3 | PPA → SPT in AAG35710. Ref.4 | ||||||
| Sequence conflict | 724 | 1 | T → D in AAG35710. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and characterization of cDNAs for the protein kinase HIPK2." Wang Y., Hofmann T.G., Runkel L., Haaf T., Schaller H., Debatin K.-M., Hug H. Biochim. Biophys. Acta 1518:168-172(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, MUTAGENESIS OF LYS-228. Tissue: Liver and Testis. |
| [2] | "Sequencing of hHIPk2, a human homolog of mouse homeodomain interacting protein kinase 2." Stukart G.C., Dias-Neto E. Submitted (DEC-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). Tissue: Frontal cortex. |
| [3] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Pierantoni G.M., Benvenuto G., Chiariotti L., Fusco A. Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 8-1198 (ISOFORM 2). |
| [5] | "The serine/threonine kinase HIPK2 interacts with TRADD, but not with CD95 or TNF-R1 in 293T cells." Li X., Wang Y., Debatin K.-M., Hug H. Biochem. Biophys. Res. Commun. 277:513-517(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TRADD. |
| [6] | "The homeodomain-interacting protein kinase 2 gene is expressed late in embryogenesis and preferentially in retina, muscle, and neural tissues." Pierantoni G.M., Bulfone A., Pentimalli F., Fedele M., Iuliano R., Santoro M., Chiariotti L., Ballabio A., Fusco A. Biochem. Biophys. Res. Commun. 290:942-947(2002) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [7] | "HIPK2 associates with RanBPM." Wang Y., Marion Schneider E., Li X., Duttenhoefer I., Debatin K.-M., Hug H. Biochem. Biophys. Res. Commun. 297:148-153(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RANBP9, SUBCELLULAR LOCATION, MUTAGENESIS OF LYS-228. |
| [8] | "Identification and characterization of HIPK2 interacting with p73 and modulating functions of the p53 family in vivo." Kim E.-J., Park J.-S., Um S.-J. J. Biol. Chem. 277:32020-32028(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TP73; TP53 AND TP63, MUTAGENESIS OF LYS-228, FUNCTION. |
| [9] | "Regulation of p53 activity by its interaction with homeodomain-interacting protein kinase-2." Hofmann T.G., Moeller A., Sirma H., Zentgraf H., Taya Y., Droege W., Will H., Schmitz M.L. Nat. Cell Biol. 4:1-10(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, AUTOPHOSPHORYLATION, INTERACTION WITH TP53 AND CREBBP, MUTAGENESIS OF LYS-228, FUNCTION, INDUCTION. |
| [10] | "PML is required for homeodomain-interacting protein kinase 2 (HIPK2)-mediated p53 phosphorylation and cell cycle arrest but is dispensable for the formation of HIPK domains." Moeller A., Sirma H., Hofmann T.G., Rueffer S., Klimczak E., Droege W., Will H., Schmitz M.L. Cancer Res. 63:4310-4314(2003) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, MUTAGENESIS OF LYS-228. |
| [11] | "HIPK2 regulates transforming growth factor-beta-induced c-Jun NH(2)-terminal kinase activation and apoptosis in human hepatoma cells." Hofmann T.G., Stollberg N., Schmitz M.L., Will H. Cancer Res. 63:8271-8277(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH DAXX, MUTAGENESIS OF LYS-228. |
| [12] | "TP53INP1s and homeodomain-interacting protein kinase-2 (HIPK2) are partners in regulating p53 activity." Tomasini R., Samir A.A., Carrier A., Isnardon D., Cecchinelli B., Soddu S., Malissen B., Dagorn J.-C., Iovanna J.L., Dusetti N.J. J. Biol. Chem. 278:37722-37729(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH P53DINP1. |
| [13] | "Requirement of the co-repressor homeodomain-interacting protein kinase 2 for ski-mediated inhibition of bone morphogenetic protein-induced transcriptional activation." Harada J., Kokura K., Kanei-Ishii C., Nomura T., Khan M.M., Kim Y., Ishii S. J. Biol. Chem. 278:38998-39005(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH SKI; SMAD1; SMAD2 AND SMAD3, MUTAGENESIS OF LYS-228 AND 359-SER--TYR-361. |
| [14] | "Desumoylation of homeodomain-interacting protein kinase 2 (HIPK2) through the cytoplasmic-nuclear shuttling of the SUMO-specific protease SENP1." Kim Y.H., Sung K.S., Lee S.-J., Kim Y.-O., Choi C.Y., Kim Y. FEBS Lett. 579:6272-6278(2005) [PubMed] [Europe PMC] [Abstract] Cited for: DESUMOYLATION. |
| [15] | "Autoregulatory control of the p53 response by caspase-mediated processing of HIPK2." Gresko E., Roscic A., Ritterhoff S., Vichalkovski A., del Sal G., Schmitz M.L. EMBO J. 25:1883-1894(2006) [PubMed] [Europe PMC] [Abstract] Cited for: CLEAVAGE BY CASP6 AT ASP-923 AND ASP-984. |
| [16] | "Phosphorylation-dependent control of Pc2 SUMO E3 ligase activity by its substrate protein HIPK2." Roscic A., Moeller A., Calzado M.A., Renner F., Wimmer V.C., Gresko E., Luedi K.S., Schmitz M.L. Mol. Cell 24:77-89(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CBX4, SUMOYLATION AT LYS-32, FUNCTION. |
| [17] | "Homeodomain-interacting protein kinase-2 (HIPK2) phosphorylates HMGA1a at Ser-35, Thr-52, and Thr-77 and modulates its DNA binding affinity." Zhang Q., Wang Y. J. Proteome Res. 6:4711-4719(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION AS HMGA1 KINASE. |
| [18] | "PEBP2-beta/CBF-beta-dependent phosphorylation of RUNX1 and p300 by HIPK2: implications for leukemogenesis." Wee H.-J., Voon D.C.-C., Bae S.-C., Ito Y. Blood 112:3777-3787(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION AS RUNX1 AND EP300 KINASE, MUTAGENESIS OF LYS-228. |
| [19] | "Ubiquitination and degradation of homeodomain-interacting protein kinase 2 by WD40 repeat/SOCS box protein WSB-1." Choi D.W., Seo Y.-M., Kim E.-A., Sung K.S., Ahn J.W., Park S.-J., Lee S.-R., Choi C.Y. J. Biol. Chem. 283:4682-4689(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH WSB1, UBIQUITINATION BY WSB1. |
| [20] | "PML activates transcription by protecting HIPK2 and p300 from SCFFbx3-mediated degradation." Shima Y., Shima T., Chiba T., Irimura T., Pandolfi P.P., Kitabayashi I. Mol. Cell. Biol. 28:7126-7138(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, UBIQUITINATION BY FBXO3. |
| [21] | "Control of HIPK2 stability by ubiquitin ligase Siah-1 and checkpoint kinases ATM and ATR." Winter M., Sombroek D., Dauth I., Moehlenbrink J., Scheuermann K., Crone J., Hofmann T.G. Nat. Cell Biol. 10:812-824(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INDUCTION BY DNA DAMAGE, INTERACTION WITH SIAH1, UBIQUITINATION BY SIAH1. |
| [22] | "Transcriptional regulation of hypoxia-inducible factor 1alpha by HIPK2 suggests a novel mechanism to restrain tumor growth." Nardinocchi L., Puca R., Guidolin D., Belloni A.S., Bossi G., Michiels C., Sacchi A., Onisto M., D'Orazi G. Biochim. Biophys. Acta 1793:368-377(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION AS HIF1A TRANSCRIPTION REGULATOR AND ANGIOGENESIS PROMOTER. |
| [23] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [24] | "PML tumor suppressor is regulated by HIPK2-mediated phosphorylation in response to DNA damage." Gresko E., Ritterhoff S., Sevilla-Perez J., Roscic A., Froebius K., Kotevic I., Vichalkovski A., Hess D., Hemmings B.A., Schmitz M.L. Oncogene 28:698-708(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION AS PML KINASE, INTERACTION WITH PML, MUTAGENESIS OF LYS-228. |
| [25] | "The human protein kinase HIPK2 phosphorylates and downregulates the methyl-binding transcription factor ZBTB4." Yamada D., Perez-Torrado R., Filion G., Caly M., Jammart B., Devignot V., Sasai N., Ravassard P., Mallet J., Sastre-Garau X., Schmitz M.L., Defossez P.A. Oncogene 28:2535-2544(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION AS ZBTB4 KINASE, INTERACTION WITH ZBTB4. |
| [26] | "Targeting hypoxia in cancer cells by restoring homeodomain interacting protein-kinase 2 and p53 activity and suppressing HIF-1alpha." Nardinocchi L., Puca R., Sacchi A., Rechavi G., Givol D., D'Orazi G. PLoS ONE 4:E6819-E6819(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INDUCTION BY ZINC DURING HYPOXIA. |
| [27] | "Pancreatic and duodenal homeobox 1 (PDX1) phosphorylation at serine-269 is HIPK2-dependent and affects PDX1 subnuclear localization." An R., da Silva Xavier G., Semplici F., Vakhshouri S., Hao H.X., Rutter J., Pagano M.A., Meggio F., Pinna L.A., Rutter G.A. Biochem. Biophys. Res. Commun. 399:155-161(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION AS PDX1 KINASE. |
| [28] | "Homeodomain-interacting protein kinase 2 (HIPK2) targets beta-catenin for phosphorylation and proteasomal degradation." Kim E.-A., Kim J.E., Sung K.S., Choi D.W., Lee B.J., Choi C.Y. Biochem. Biophys. Res. Commun. 394:966-971(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION AS CTNNB1 KINASE. |
| [29] | "Transcriptional regulation of ferritin and antioxidant genes by HIPK2 under genotoxic stress." Hailemariam K., Iwasaki K., Huang B.W., Sakamoto K., Tsuji Y. J. Cell Sci. 123:3863-3871(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION AS ATF1 KINASE, INTERACTION WITH ATF1. |
| [30] | "Regulation of genotoxic stress response by homeodomain-interacting protein kinase 2 through phosphorylation of cyclic AMP response element-binding protein at serine 271." Sakamoto K., Huang B.-W., Iwasaki K., Hailemariam K., Ninomiya-Tsuji J., Tsuji Y. Mol. Biol. Cell 21:2966-2974(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION AS CREB1 KINASE, INTERACTION WITH CREB1. |
| [31] | "Control of nuclear HIPK2 localization and function by a SUMO interaction motif." de la Vega L., Froebius K., Moreno R., Calzado M.A., Geng H., Schmitz M.L. Biochim. Biophys. Acta 1813:283-297(2011) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, SUMOYLATION, NUCLEAR LOCALIZATION SIGNALS, MUTAGENESIS OF LYS-803; LYS-805; ARG-833; LYS-835; 885-VAL--SER-892 AND 893-ASP--GLU-899, INTERACTION WITH CBX4. |
| [32] | "Role of the SUMO-interacting motif in HIPK2 targeting to the PML nuclear bodies and regulation of p53." Sung K.S., Lee Y.A., Kim E.T., Lee S.R., Ahn J.H., Choi C.Y. Exp. Cell Res. 317:1060-1070(2011) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, SUMOYLATION, FUNCTION, MUTAGENESIS OF 885-VAL--ILE-888 AND 892-SER--ASP-895. |
| [33] | "How cells switch HIPK2 on and off." Sombroek D., Hofmann T.G. Cell Death Differ. 16:187-194(2009) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON DNA DAMAGE SIGNALING, INDUCTION BY GENOTOXIC AGENTS, STABILIZATION BY DNA DAMAGE. |
| [34] | "Apoptosis and autophagy: Regulation of apoptosis by DNA damage signalling - roles of p53, p73 and HIPK2." Bitomsky N., Hofmann T.G. FEBS J. 276:6074-6083(2009) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [35] | "HIPK2-a therapeutical target to be (re)activated for tumor suppression: role in p53 activation and HIF-1? inhibition." Nardinocchi L., Puca R., Givol D., D'Orazi G. Cell Cycle 9:1270-1275(2010) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW AS HYPOXIA AND TP53 REGULATOR. |
| [36] | "Regulation of p53 activity by HIPK2: molecular mechanisms and therapeutical implications in human cancer cells." Puca R., Nardinocchi L., Givol D., D'Orazi G. Oncogene 29:4378-4387(2010) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW AS TP53 REGULATOR, INDUCTION BY GENOTOXIC AGENTS AND HYPOXIA. |
| [37] | "DNA damage-induced heterogeneous nuclear ribonucleoprotein K SUMOylation regulates p53 transcriptional activation." Pelisch F., Pozzi B., Risso G., Munoz M.J., Srebrow A. J. Biol. Chem. 287:30789-30799(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [38] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] GLN-792 AND GLN-1027. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF208291 mRNA. Translation: AAG41236.1. AF326592 mRNA. Translation: AAL37371.1. AC005531 Genomic DNA. Translation: AAS00368.1. AC073184 Genomic DNA. No translation available. AC006021 Genomic DNA. No translation available. AC141932 Genomic DNA. No translation available. AF207702 mRNA. Translation: AAG35710.1. |
| IPI | IPI00215949. IPI00215950. IPI00289892. |
| RefSeq | NP_001106710.1. NM_001113239.2. NP_073577.3. NM_022740.4. |
| UniGene | Hs.731417. |
3D structure databases | |
| ProteinModelPortal | Q9H2X6. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9H2X6. 9 interactions. |
| MINT | MINT-234689. |
| STRING | 9606.ENSP00000263551. |
PTM databases | |
| PhosphoSite | Q9H2X6. |
Polymorphism databases | |
| DMDM | 21431782. |
Proteomic databases | |
| PaxDb | Q9H2X6. |
| PRIDE | Q9H2X6. |
Protocols and materials databases | |
| DNASU | 28996. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000406875; ENSP00000385571; ENSG00000064393. ENST00000428878; ENSP00000413724; ENSG00000064393. |
| GeneID | 28996. |
| KEGG | hsa:28996. |
| UCSC | uc003vvd.4. human. uc003vvf.4. human. |
Organism-specific databases | |
| CTD | 28996. |
| GeneCards | GC07M139246. |
| HGNC | HGNC:14402. HIPK2. |
| HPA | HPA007611. |
| MIM | 606868. gene. |
| neXtProt | NX_Q9H2X6. |
| PharmGKB | PA29291. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0515. |
| HOGENOM | HOG000231785. |
| HOVERGEN | HBG051908. |
| InParanoid | Q9H2X6. |
| KO | K08826. |
| OMA | MIQNNAS. |
| OrthoDB | EOG4CVG63. |
| PhylomeDB | Q9H2X6. |
Enzyme and pathway databases | |
| BRENDA | 2.7.11.1. 2681. |
Gene expression databases | |
| ArrayExpress | Q9H2X6. |
| Bgee | Q9H2X6. |
| CleanEx | HS_HIPK2. |
| Genevestigator | Q9H2X6. |
| GermOnline | ENSG00000064393. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q9H2X6. |
| ChEMBL | CHEMBL4576. |
| ChiTaRS | HIPK2. human. |
| GenomeRNAi | 28996. |
| NextBio | 51926. |
| PMAP-CutDB | Q9H2X6. |
| SOURCE | Search... |
Entry information
| Entry name | HIPK2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H2X6 Secondary accession number(s): Q75MR7, Q8WWI4, Q9H2Y1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
