Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Membrane-spanning 4-domains subfamily A member 6A

Gene

MS4A6A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

May be involved in signal transduction as a component of a multimeric receptor complex.

Keywords - Molecular functioni

Receptor

Names & Taxonomyi

Protein namesi
Recommended name:
Membrane-spanning 4-domains subfamily A member 6A
Alternative name(s):
CD20 antigen-like 3
Four-span transmembrane protein 3
Gene namesi
Name:MS4A6A
Synonyms:4SPAN3, CD20L3, MS4A6
ORF Names:CDA01, MSTP090
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:13375. MS4A6A.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 4646CytoplasmicSequence analysisAdd
BLAST
Transmembranei47 – 6721HelicalSequence analysisAdd
BLAST
Topological domaini68 – 8417ExtracellularSequence analysisAdd
BLAST
Transmembranei85 – 10521HelicalSequence analysisAdd
BLAST
Topological domaini106 – 11611CytoplasmicSequence analysisAdd
BLAST
Transmembranei117 – 13721HelicalSequence analysisAdd
BLAST
Topological domaini138 – 18548ExtracellularSequence analysisAdd
BLAST
Transmembranei186 – 20621HelicalSequence analysisAdd
BLAST
Topological domaini207 – 24842CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31119.

Polymorphism and mutation databases

BioMutaiMS4A6A.
DMDMi30580461.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 248248Membrane-spanning 4-domains subfamily A member 6APRO_0000158638Add
BLAST

Proteomic databases

EPDiQ9H2W1.
PaxDbiQ9H2W1.
PRIDEiQ9H2W1.

PTM databases

iPTMnetiQ9H2W1.
PhosphoSiteiQ9H2W1.

Expressioni

Tissue specificityi

Variable expression in some B-cell, myelomonocytic, and erythroleukemia cell lines.

Gene expression databases

BgeeiQ9H2W1.
ExpressionAtlasiQ9H2W1. baseline and differential.
GenevisibleiQ9H2W1. HS.

Organism-specific databases

HPAiHPA011391.

Interactioni

Protein-protein interaction databases

IntActiQ9H2W1. 3 interactions.
MINTiMINT-6598591.
STRINGi9606.ENSP00000315878.

Structurei

3D structure databases

ProteinModelPortaliQ9H2W1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the MS4A family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J2FM. Eukaryota.
ENOG41116U4. LUCA.
GeneTreeiENSGT00510000047037.
HOVERGENiHBG052387.
InParanoidiQ9H2W1.
OrthoDBiEOG7HMS2B.
PhylomeDBiQ9H2W1.
TreeFamiTF335157.

Family and domain databases

InterProiIPR007237. CD20-like.
IPR030417. MS4A.
IPR030427. MS4A6A/MS4A6E.
[Graphical view]
PANTHERiPTHR23320. PTHR23320. 1 hit.
PTHR23320:SF46. PTHR23320:SF46. 1 hit.
PfamiPF04103. CD20. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H2W1-1) [UniParc]FASTAAdd to basket

Also known as: 3.1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTSQPVPNET IIVLPSNVIN FSQAEKPEPT NQGQDSLKKH LHAEIKVIGT
60 70 80 90 100
IQILCGMMVL SLGIILASAS FSPNFTQVTS TLLNSAYPFI GPFFFIISGS
110 120 130 140 150
LSIATEKRLT KLLVHSSLVG SILSALSALV GFIILSVKQA TLNPASLQCE
160 170 180 190 200
LDKNNIPTRS YVSYFYHDSL YTTDCYTAKA SLAGTLSLML ICTLLEFCLA
210 220 230 240
VLTAVLRWKQ AYSDFPGSVL FLPHSYIGNS GMSSKMTHDC GYEELLTS
Length:248
Mass (Da):26,943
Last modified:March 1, 2001 - v1
Checksum:i49892BC25D220A23
GO
Isoform 2 (identifier: Q9H2W1-2) [UniParc]FASTAAdd to basket

Also known as: 3.2

The sequence of this isoform differs from the canonical sequence as follows:
     218-225: SVLFLPHS → VSVLAGFT
     226-248: Missing.

Show »
Length:225
Mass (Da):24,331
Checksum:i12FBF5DCDC71B56A
GO
Isoform 3 (identifier: Q9H2W1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     149-178: CELDKNNIPTRSYVSYFYHDSLYTTDCYTA → WNSLSDADLHSAGILPSCAHCCAAVETGLL
     179-248: Missing.

Show »
Length:178
Mass (Da):18,801
Checksum:i54E100285530D914
GO
Isoform 4 (identifier: Q9H2W1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     95-141: FIISGSLSIA...FIILSVKQAT → VSRVSEEGRM...VNGESCSPVG
     142-248: Missing.

Show »
Length:141
Mass (Da):15,108
Checksum:iFEB8B36B852C4576
GO
Isoform 5 (identifier: Q9H2W1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVLLKLLEVYRKGSAGTFHKSTIFGNTIM
     218-225: SVLFLPHS → VSVLAGFT
     226-248: Missing.

Note: No experimental confirmation available.
Show »
Length:253
Mass (Da):27,438
Checksum:i4E4BEF6D13026463
GO

Sequence cautioni

The sequence AAG44626.1 differs from that shown. Reason: Frameshift at position 115. Curated
The sequence AAG44672.1 differs from that shown. Reason: Frameshift at positions 68 and 103. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti107 – 1071K → R in AAL56222 (Ref. 6) Curated
Sequence conflicti107 – 1071K → R in AAL56223 (Ref. 6) Curated
Sequence conflicti110 – 1101T → S in AAL56222 (Ref. 6) Curated
Sequence conflicti110 – 1101T → S in AAL56223 (Ref. 6) Curated
Sequence conflicti225 – 2251S → R in AAL56222 (Ref. 6) Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti183 – 1831A → S.1 Publication
VAR_015652
Natural varianti185 – 1851T → S.1 Publication
Corresponds to variant rs7232 [ dbSNP | Ensembl ].
VAR_015653

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MVLLKLLEVYRKGSAGTFHK STIFGNTIM in isoform 5. CuratedVSP_056732
Alternative sequencei95 – 14147FIISG…VKQAT → VSRVSEEGRMGQRGEEDANS LDFPPASLLCLICQEQGVNG ESCSPVG in isoform 4. 1 PublicationVSP_041191Add
BLAST
Alternative sequencei142 – 248107Missing in isoform 4. 1 PublicationVSP_041192Add
BLAST
Alternative sequencei149 – 17830CELDK…DCYTA → WNSLSDADLHSAGILPSCAH CCAAVETGLL in isoform 3. 1 PublicationVSP_007383Add
BLAST
Alternative sequencei179 – 24870Missing in isoform 3. 1 PublicationVSP_007384Add
BLAST
Alternative sequencei218 – 2258SVLFLPHS → VSVLAGFT in isoform 2 and isoform 5. 3 PublicationsVSP_007381
Alternative sequencei226 – 24823Missing in isoform 2 and isoform 5. 3 PublicationsVSP_007382Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB013104 mRNA. Translation: BAB18740.1.
AF237908 mRNA. Translation: AAK37417.1.
AF286866 mRNA. Translation: AAK37994.1.
AF354930 mRNA. Translation: AAL07357.1.
AF142409 mRNA. Translation: AAG27920.1.
AF253977 mRNA. Translation: AAG44626.1. Frameshift.
AF261136 mRNA. Translation: AAG44672.1. Frameshift.
AF350502 mRNA. Translation: AAL56222.1.
AF350503 mRNA. Translation: AAL56223.1.
AF172819 mRNA. Translation: AAQ13613.1.
AF212240 mRNA. Translation: AAG41780.1.
AK291870 mRNA. Translation: BAF84559.1.
AP003970 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW73867.1.
BC022854 mRNA. Translation: AAH22854.1.
CCDSiCCDS44615.1. [Q9H2W1-2]
CCDS44616.1. [Q9H2W1-3]
CCDS58134.1. [Q9H2W1-5]
CCDS7981.1. [Q9H2W1-1]
RefSeqiNP_001234928.1. NM_001247999.1. [Q9H2W1-5]
NP_071744.2. NM_022349.3. [Q9H2W1-2]
NP_690590.1. NM_152851.2. [Q9H2W1-3]
NP_690591.1. NM_152852.2. [Q9H2W1-1]
XP_006718722.1. XM_006718659.1. [Q9H2W1-5]
XP_011543510.1. XM_011545208.1. [Q9H2W1-1]
UniGeneiHs.523702.
Hs.744932.

Genome annotation databases

EnsembliENST00000412309; ENSP00000403212; ENSG00000110077. [Q9H2W1-5]
ENST00000420732; ENSP00000392921; ENSG00000110077. [Q9H2W1-3]
ENST00000426738; ENSP00000392770; ENSG00000110077. [Q9H2W1-5]
ENST00000528851; ENSP00000431901; ENSG00000110077. [Q9H2W1-2]
ENST00000530839; ENSP00000436979; ENSG00000110077. [Q9H2W1-1]
ENST00000532169; ENSP00000431266; ENSG00000110077. [Q9H2W1-4]
GeneIDi64231.
KEGGihsa:64231.
UCSCiuc001noq.4. human. [Q9H2W1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB013104 mRNA. Translation: BAB18740.1.
AF237908 mRNA. Translation: AAK37417.1.
AF286866 mRNA. Translation: AAK37994.1.
AF354930 mRNA. Translation: AAL07357.1.
AF142409 mRNA. Translation: AAG27920.1.
AF253977 mRNA. Translation: AAG44626.1. Frameshift.
AF261136 mRNA. Translation: AAG44672.1. Frameshift.
AF350502 mRNA. Translation: AAL56222.1.
AF350503 mRNA. Translation: AAL56223.1.
AF172819 mRNA. Translation: AAQ13613.1.
AF212240 mRNA. Translation: AAG41780.1.
AK291870 mRNA. Translation: BAF84559.1.
AP003970 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW73867.1.
BC022854 mRNA. Translation: AAH22854.1.
CCDSiCCDS44615.1. [Q9H2W1-2]
CCDS44616.1. [Q9H2W1-3]
CCDS58134.1. [Q9H2W1-5]
CCDS7981.1. [Q9H2W1-1]
RefSeqiNP_001234928.1. NM_001247999.1. [Q9H2W1-5]
NP_071744.2. NM_022349.3. [Q9H2W1-2]
NP_690590.1. NM_152851.2. [Q9H2W1-3]
NP_690591.1. NM_152852.2. [Q9H2W1-1]
XP_006718722.1. XM_006718659.1. [Q9H2W1-5]
XP_011543510.1. XM_011545208.1. [Q9H2W1-1]
UniGeneiHs.523702.
Hs.744932.

3D structure databases

ProteinModelPortaliQ9H2W1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ9H2W1. 3 interactions.
MINTiMINT-6598591.
STRINGi9606.ENSP00000315878.

PTM databases

iPTMnetiQ9H2W1.
PhosphoSiteiQ9H2W1.

Polymorphism and mutation databases

BioMutaiMS4A6A.
DMDMi30580461.

Proteomic databases

EPDiQ9H2W1.
PaxDbiQ9H2W1.
PRIDEiQ9H2W1.

Protocols and materials databases

DNASUi64231.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000412309; ENSP00000403212; ENSG00000110077. [Q9H2W1-5]
ENST00000420732; ENSP00000392921; ENSG00000110077. [Q9H2W1-3]
ENST00000426738; ENSP00000392770; ENSG00000110077. [Q9H2W1-5]
ENST00000528851; ENSP00000431901; ENSG00000110077. [Q9H2W1-2]
ENST00000530839; ENSP00000436979; ENSG00000110077. [Q9H2W1-1]
ENST00000532169; ENSP00000431266; ENSG00000110077. [Q9H2W1-4]
GeneIDi64231.
KEGGihsa:64231.
UCSCiuc001noq.4. human. [Q9H2W1-1]

Organism-specific databases

CTDi64231.
GeneCardsiMS4A6A.
HGNCiHGNC:13375. MS4A6A.
HPAiHPA011391.
MIMi606548. gene.
neXtProtiNX_Q9H2W1.
PharmGKBiPA31119.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J2FM. Eukaryota.
ENOG41116U4. LUCA.
GeneTreeiENSGT00510000047037.
HOVERGENiHBG052387.
InParanoidiQ9H2W1.
OrthoDBiEOG7HMS2B.
PhylomeDBiQ9H2W1.
TreeFamiTF335157.

Miscellaneous databases

ChiTaRSiMS4A6A. human.
GenomeRNAii64231.
PROiQ9H2W1.
SOURCEiSearch...

Gene expression databases

BgeeiQ9H2W1.
ExpressionAtlasiQ9H2W1. baseline and differential.
GenevisibleiQ9H2W1. HS.

Family and domain databases

InterProiIPR007237. CD20-like.
IPR030417. MS4A.
IPR030427. MS4A6A/MS4A6E.
[Graphical view]
PANTHERiPTHR23320. PTHR23320. 1 hit.
PTHR23320:SF46. PTHR23320:SF46. 1 hit.
PfamiPF04103. CD20. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a new multigene four-transmembrane family (MS4A) related to CD20, HTm4 and beta subunit of the high-affinity IgE receptor."
    Ishibashi K., Suzuki M., Sasaki S., Imai M.
    Gene 264:87-93(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  2. "Identification of a CD20-, Fc-epsilon-RI-beta-, and HTm4-related gene family: sixteen new MS4A family members expressed in human and mouse."
    Liang Y., Tedder T.F.
    Genomics 72:119-127(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS SER-183 AND SER-185.
    Tissue: Liver and Spleen.
  3. "Structural organization of the human MS4A gene cluster on chromosome 11q12."
    Liang Y., Buckley T.R., Tu L., Langdon S.D., Tedder T.F.
    Immunogenetics 53:357-368(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Fetal liver.
  4. "Novel human CD20-like molecule."
    Zhang W., Wan T., He L., Yuan Z., Cao X.
    Submitted (APR-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  5. Xu X., Yang Y., Gao G., Xiao H., Chen Z., Han Z.
    Submitted (MAY-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Dendritic cell.
  6. "Isolation of a family of hematopoietic-expressed four-transmembrane genes related to CD20 and Fc-epsilon-RI-beta."
    Hulett M.D., Pagler E., Hogarth P.M., Eyre H.J., Baker E., Crawford J., Sutherland G.R., Parish C.R.
    Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Aorta.
  8. "A novel gene expressed in human pheochromocytoma."
    Li Y., Huang Q., Peng Y., Song H., Yu Y., Xu S., Ren S., Chen Z., Han Z.
    Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Pheochromocytoma.
  9. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Skeletal muscle.
  10. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  11. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  12. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Skeletal muscle.

Entry informationi

Entry nameiM4A6A_HUMAN
AccessioniPrimary (citable) accession number: Q9H2W1
Secondary accession number(s): A8K755
, F8W9K1, Q7Z4E8, Q8TBV7, Q8TEZ4, Q8TEZ5, Q96PG6, Q9H2L1, Q9H2N3, Q9H3V1, Q9HC76
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 9, 2003
Last sequence update: March 1, 2001
Last modified: June 8, 2016
This is version 123 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.