Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9H2P9 (DPH5_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 105. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Diphthine synthase

EC=2.1.1.98
Alternative name(s):
Diphthamide biosynthesis methyltransferase
Gene names
Name:DPH5
ORF Names:AD-018, CGI-30, HSPC143, NPD015
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length285 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the trimethylation of the amino group of the modified target histidine residue in translation elongation factor 2 (EEF2), to form an intermediate called diphthine. The three successive methylation reactions represent the second step of diphthamide biosynthesis. Ref.10

Catalytic activity

3 S-adenosyl-L-methionine + 2-(3-carboxy-3-aminopropyl)-L-histidine-[translation elongation factor 2] = 3 S-adenosyl-L-homocysteine + 2-(3-carboxy-3-(trimethylammonio)propyl)-L-histidine-[translation elongation factor 2]. HAMAP-Rule MF_01084

Pathway

Protein modification; peptidyl-diphthamide biosynthesis. HAMAP-Rule MF_01084

Sequence similarities

Belongs to the diphthine synthase family.

Ontologies

Alternative products

This entry describes 6 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9H2P9-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9H2P9-2)

The sequence of this isoform differs from the canonical sequence as follows:
     85-137: PFGATTHSDLVLRATKLGIPYRVIHNASIMNAVGCCGLQLYKFGETVSIVFWT → HL
Note: No experimental confirmation available.
Isoform 3 (identifier: Q9H2P9-3)

The sequence of this isoform differs from the canonical sequence as follows:
     88-143: ATTHSDLVLRATKLGIPYRVIHNASIMNAVGCCGLQLYKFGETVSIVFWTDTWRPE → HLETR
Note: No experimental confirmation available.
Isoform 4 (identifier: Q9H2P9-4)

The sequence of this isoform differs from the canonical sequence as follows:
     117-141: VGCCGLQLYKFGETVSIVFWTDTWR → EAAGGYRYISLERQVLLVFGQTLGG
Note: No experimental confirmation available.
Isoform 5 (identifier: Q9H2P9-5)

The sequence of this isoform differs from the canonical sequence as follows:
     134-137: VFWT → MLISVMLHSLWLVIHL
Note: No experimental confirmation available.
Isoform 6 (identifier: Q9H2P9-6)

The sequence of this isoform differs from the canonical sequence as follows:
     212-212: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 285285Diphthine synthase HAMAP-Rule MF_01084
PRO_0000156133

Regions

Region112 – 1132S-adenosyl-L-methionine binding By similarity

Sites

Binding site91S-adenosyl-L-methionine; via carbonyl oxygen By similarity
Binding site841S-adenosyl-L-methionine; via amide nitrogen and carbonyl oxygen By similarity
Binding site871S-adenosyl-L-methionine; via carbonyl oxygen By similarity
Binding site1631S-adenosyl-L-methionine; via amide nitrogen and carbonyl oxygen By similarity
Binding site2251S-adenosyl-L-methionine; via amide nitrogen and carbonyl oxygen By similarity
Binding site2501S-adenosyl-L-methionine; via carbonyl oxygen By similarity

Natural variations

Alternative sequence85 – 13753PFGAT…IVFWT → HL in isoform 2.
VSP_008508
Alternative sequence88 – 14356ATTHS…TWRPE → HLETR in isoform 3.
VSP_008509
Alternative sequence117 – 14125VGCCG…TDTWR → EAAGGYRYISLERQVLLVFG QTLGG in isoform 4.
VSP_008510
Alternative sequence134 – 1374VFWT → MLISVMLHSLWLVIHL in isoform 5.
VSP_008511
Alternative sequence2121Missing in isoform 6.
VSP_043444

Experimental info

Sequence conflict1071V → G in AAG44563. Ref.4
Sequence conflict2851L → FEHRYFHCLM in AAF67485. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 10, 2003. Version 2.
Checksum: 1348631C25BC624E

FASTA28531,651
        10         20         30         40         50         60 
MLYLIGLGLG DAKDITVKGL EVVRRCSRVY LEAYTSVLTV GKEALEEFYG RKLVVADREE 

        70         80         90        100        110        120 
VEQEADNILK DADISDVAFL VVGDPFGATT HSDLVLRATK LGIPYRVIHN ASIMNAVGCC 

       130        140        150        160        170        180 
GLQLYKFGET VSIVFWTDTW RPESFFDKVK KNRQNGMHTL CLLDIKVKEQ SLENLIKGRK 

       190        200        210        220        230        240 
IYEPPRYMSV NQAAQQLLEI VQNQRIRGEE PAVTEETLCV GLARVGADDQ KIAAGTLRQM 

       250        260        270        280 
CTVDLGEPLH SLIITGGSIH PMEMEMLSLF SIPENSSESQ SINGL 

« Hide

Isoform 2 [UniParc].

Checksum: CAA1ABE0A11AF714
Show »

FASTA23426,122
Isoform 3 [UniParc].

Checksum: 86A9E6761145DFBA
Show »

FASTA23426,025
Isoform 4 [UniParc].

Checksum: 2784D835EB96EFC2
Show »

FASTA28531,440
Isoform 5 [UniParc].

Checksum: E0D27EEEF0B9849D
Show »

FASTA29733,005
Isoform 6 [UniParc].

Checksum: 862A9762E32AA574
Show »

FASTA28431,580

References

« Hide 'large scale' references
[1]"Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics."
Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C.
Genome Res. 10:703-713(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
[2]"Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning."
Hu R.-M., Han Z.-G., Song H.-D., Peng Y.-D., Huang Q.-H., Ren S.-X., Gu Y.-J., Huang C.-H., Li Y.-B., Jiang C.-L., Fu G., Zhang Q.-H., Gu B.-W., Dai M., Mao Y.-F., Gao G.-F., Rong R., Ye M. expand/collapse author list , Zhou J., Xu S.-H., Gu J., Shi J.-X., Jin W.-R., Zhang C.-K., Wu T.-M., Huang G.-Y., Chen Z., Chen M.-D., Chen J.-L.
Proc. Natl. Acad. Sci. U.S.A. 97:9543-9548(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Adrenal gland.
[3]"Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. expand/collapse author list , Gu J., Chen S.-J., Chen Z.
Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Umbilical cord blood.
[4]Yang Y., Xu X., Gao G., Xiao H., Chen Z., Han Z.
Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Tissue: Pituitary.
[5]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
[6]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Eye.
[9]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[10]"A modified form of diphthamide causes immunotoxin resistance in a lymphoma cell line with a deletion of the WDR85 gene."
Wei H., Bera T.K., Wayne A.S., Xiang L., Colantonio S., Chertov O., Pastan I.
J. Biol. Chem. 288:12305-12312(2013) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION IN DIPHTHAMIDE BIOSYNTHESIS.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF132964 mRNA. Translation: AAD27739.1.
AF157319 mRNA. Translation: AAF67485.1.
AF161492 mRNA. Translation: AAF29107.1.
AF248965 mRNA. Translation: AAG44563.1.
AK289351 mRNA. Translation: BAF82040.1.
AC093157 Genomic DNA. No translation available.
CH471097 Genomic DNA. Translation: EAW72933.1.
CH471097 Genomic DNA. Translation: EAW72937.1.
CH471097 Genomic DNA. Translation: EAW72938.1.
CH471097 Genomic DNA. Translation: EAW72940.1.
BC053857 mRNA. Translation: AAH53857.1.
CCDSCCDS41358.1. [Q9H2P9-1]
CCDS41359.1. [Q9H2P9-6]
RefSeqNP_001070862.1. NM_001077394.1. [Q9H2P9-1]
NP_001070863.1. NM_001077395.1. [Q9H2P9-6]
NP_057042.2. NM_015958.2. [Q9H2P9-1]
UniGeneHs.440776.

3D structure databases

ProteinModelPortalQ9H2P9.
SMRQ9H2P9. Positions 1-270.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid119637. 1 interaction.
STRING9606.ENSP00000359127.

PTM databases

PhosphoSiteQ9H2P9.

Polymorphism databases

DMDM46397414.

Proteomic databases

MaxQBQ9H2P9.
PaxDbQ9H2P9.
PRIDEQ9H2P9.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000342173; ENSP00000339630; ENSG00000117543. [Q9H2P9-6]
ENST00000370109; ENSP00000359127; ENSG00000117543. [Q9H2P9-1]
ENST00000488176; ENSP00000418282; ENSG00000117543. [Q9H2P9-1]
GeneID51611.
KEGGhsa:51611.
UCSCuc001dtr.2. human. [Q9H2P9-6]
uc001dts.2. human. [Q9H2P9-1]
uc001dty.2. human. [Q9H2P9-5]

Organism-specific databases

CTD51611.
GeneCardsGC01M101455.
H-InvDBHIX0023161.
HGNCHGNC:24270. DPH5.
HPAHPA046439.
MIM611075. gene.
neXtProtNX_Q9H2P9.
PharmGKBPA142671956.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG1798.
HOGENOMHOG000205302.
HOVERGENHBG044879.
InParanoidQ9H2P9.
KOK00586.
OMAQQMCTVD.
OrthoDBEOG7Q2N64.
PhylomeDBQ9H2P9.
TreeFamTF105603.

Enzyme and pathway databases

UniPathwayUPA00559.

Gene expression databases

ArrayExpressQ9H2P9.
BgeeQ9H2P9.
CleanExHS_DPH5.
GenevestigatorQ9H2P9.

Family and domain databases

Gene3D3.30.950.10. 1 hit.
3.40.1010.10. 1 hit.
HAMAPMF_01084. Diphthine_synth.
InterProIPR000878. 4pyrrol_Mease.
IPR014777. 4pyrrole_Mease_sub1.
IPR014776. 4pyrrole_Mease_sub2.
IPR004551. Dphthn_synthase.
[Graphical view]
PfamPF00590. TP_methylase. 1 hit.
[Graphical view]
PIRSFPIRSF036432. Diphthine_synth. 1 hit.
SUPFAMSSF53790. SSF53790. 1 hit.
TIGRFAMsTIGR00522. dph5. 1 hit.
ProtoNetSearch...

Other

ChiTaRSDPH5. human.
GeneWikiDPH5.
GenomeRNAi51611.
NextBio55510.
PROQ9H2P9.
SOURCESearch...

Entry information

Entry nameDPH5_HUMAN
AccessionPrimary (citable) accession number: Q9H2P9
Secondary accession number(s): A8JZY6 expand/collapse secondary AC list , D3DT62, Q9P017, Q9P0I4, Q9Y319
Entry history
Integrated into UniProtKB/Swiss-Prot: October 10, 2003
Last sequence update: October 10, 2003
Last modified: July 9, 2014
This is version 105 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PATHWAY comments

Index of metabolic and biosynthesis pathways

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM