Q9H2P9 (DPH5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 94.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Diphthine synthase EC=2.1.1.98 Alternative name(s): Diphthamide biosynthesis methyltransferase | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 285 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the trimethylation of the amino group of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine. The three successive methylation reactions represent the second step of diphthamide biosynthesis By similarity. |
| Catalytic activity | 3 S-adenosyl-L-methionine + 2-(3-carboxy-3-aminopropyl)-L-histidine = 3 S-adenosyl-L-homocysteine + 2-(3-carboxy-3-(trimethylammonio)propyl)-L-histidine. |
| Pathway | |
| Sequence similarities | Belongs to the diphthine synthase family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | S-adenosyl-L-methionine |
| Molecular function | Methyltransferase Transferase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | peptidyl-diphthamide biosynthetic process from peptidyl-histidine Non-traceable author statement PubMed 15485916. Source: UniProtKB |
| Molecular_function | diphthine synthase activity Non-traceable author statement PubMed 15485916. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9H2P9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9H2P9-2) The sequence of this isoform differs from the canonical sequence as follows: 85-137: PFGATTHSDLVLRATKLGIPYRVIHNASIMNAVGCCGLQLYKFGETVSIVFWT → HL | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9H2P9-3) The sequence of this isoform differs from the canonical sequence as follows: 88-143: ATTHSDLVLRATKLGIPYRVIHNASIMNAVGCCGLQLYKFGETVSIVFWTDTWRPE → HLETR | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q9H2P9-4) The sequence of this isoform differs from the canonical sequence as follows: 117-141: VGCCGLQLYKFGETVSIVFWTDTWR → EAAGGYRYISLERQVLLVFGQTLGG | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q9H2P9-5) The sequence of this isoform differs from the canonical sequence as follows: 134-137: VFWT → MLISVMLHSLWLVIHL | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: Q9H2P9-6) The sequence of this isoform differs from the canonical sequence as follows: 212-212: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 285 | 285 | Diphthine synthase | PRO_0000156133 | |||||
Regions | |||||||||
| Region | 112 – 113 | 2 | S-adenosyl-L-methionine binding By similarity | ||||||
Sites | |||||||||
| Binding site | 9 | 1 | S-adenosyl-L-methionine; via carbonyl oxygen By similarity | ||||||
| Binding site | 84 | 1 | S-adenosyl-L-methionine; via amide nitrogen and carbonyl oxygen By similarity | ||||||
| Binding site | 87 | 1 | S-adenosyl-L-methionine; via carbonyl oxygen By similarity | ||||||
| Binding site | 163 | 1 | S-adenosyl-L-methionine; via amide nitrogen and carbonyl oxygen By similarity | ||||||
| Binding site | 225 | 1 | S-adenosyl-L-methionine; via amide nitrogen and carbonyl oxygen By similarity | ||||||
| Binding site | 250 | 1 | S-adenosyl-L-methionine; via carbonyl oxygen By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 85 – 137 | 53 | PFGAT…IVFWT → HL in isoform 2. | VSP_008508 | |||||
| Alternative sequence | 88 – 143 | 56 | ATTHS…TWRPE → HLETR in isoform 3. | VSP_008509 | |||||
| Alternative sequence | 117 – 141 | 25 | VGCCG…TDTWR → EAAGGYRYISLERQVLLVFG QTLGG in isoform 4. | VSP_008510 | |||||
| Alternative sequence | 134 – 137 | 4 | VFWT → MLISVMLHSLWLVIHL in isoform 5. | VSP_008511 | |||||
| Alternative sequence | 212 | 1 | Missing in isoform 6. | VSP_043444 | |||||
Experimental info | |||||||||
| Sequence conflict | 107 | 1 | V → G in AAG44563. Ref.4 | ||||||
| Sequence conflict | 285 | 1 | L → FEHRYFHCLM in AAF67485. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics." Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C. Genome Res. 10:703-713(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5). |
| [2] | "Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning." Hu R.-M., Han Z.-G., Song H.-D., Peng Y.-D., Huang Q.-H., Ren S.-X., Gu Y.-J., Huang C.-H., Li Y.-B., Jiang C.-L., Fu G., Zhang Q.-H., Gu B.-W., Dai M., Mao Y.-F., Gao G.-F., Rong R., Ye M. Chen J.-L.Proc. Natl. Acad. Sci. U.S.A. 97:9543-9548(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Adrenal gland. |
| [3] | "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells." Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. Chen Z.Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Umbilical cord blood. |
| [4] | Yang Y., Xu X., Gao G., Xiao H., Chen Z., Han Z. Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Pituitary. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6). |
| [6] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Eye. |
| [9] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF132964 mRNA. Translation: AAD27739.1. AF157319 mRNA. Translation: AAF67485.1. AF161492 mRNA. Translation: AAF29107.1. AF248965 mRNA. Translation: AAG44563.1. AK289351 mRNA. Translation: BAF82040.1. AC093157 Genomic DNA. No translation available. CH471097 Genomic DNA. Translation: EAW72933.1. CH471097 Genomic DNA. Translation: EAW72937.1. CH471097 Genomic DNA. Translation: EAW72938.1. CH471097 Genomic DNA. Translation: EAW72940.1. BC053857 mRNA. Translation: AAH53857.1. |
| IPI | IPI00006419. IPI00375822. IPI00375823. IPI00375824. IPI00902709. IPI00941449. |
| RefSeq | NP_001070862.1. NM_001077394.1. NP_001070863.1. NM_001077395.1. NP_057042.2. NM_015958.2. |
| UniGene | Hs.440776. |
3D structure databases | |
| ProteinModelPortal | Q9H2P9. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000359127. |
PTM databases | |
| PhosphoSite | Q9H2P9. |
Polymorphism databases | |
| DMDM | 46397414. |
Proteomic databases | |
| PaxDb | Q9H2P9. |
| PRIDE | Q9H2P9. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000342173; ENSP00000339630; ENSG00000117543. ENST00000370109; ENSP00000359127; ENSG00000117543. ENST00000488176; ENSP00000418282; ENSG00000117543. |
| GeneID | 51611. |
| KEGG | hsa:51611. |
| UCSC | uc001dts.2. human. uc001dty.2. human. |
Organism-specific databases | |
| CTD | 51611. |
| GeneCards | GC01M101455. |
| H-InvDB | HIX0023161. |
| HGNC | HGNC:24270. DPH5. |
| HPA | HPA046439. |
| MIM | 611075. gene. |
| neXtProt | NX_Q9H2P9. |
| PharmGKB | PA142671956. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1798. |
| HOGENOM | HOG000205302. |
| HOVERGEN | HBG044879. |
| InParanoid | Q9H2P9. |
| KO | K00586. |
| OMA | TTHVDLR. |
| OrthoDB | EOG4M65J4. |
| PhylomeDB | Q9H2P9. |
Enzyme and pathway databases | |
| UniPathway | UPA00559. |
Gene expression databases | |
| ArrayExpress | Q9H2P9. |
| Bgee | Q9H2P9. |
| CleanEx | HS_DPH5. |
| Genevestigator | Q9H2P9. |
| GermOnline | ENSG00000117543. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.950.10. 1 hit. 3.40.1010.10. 1 hit. |
| InterPro | IPR000878. 4pyrrol_Mease. IPR014777. 4pyrrole_Mease_sub1. IPR014776. 4pyrrole_Mease_sub2. IPR004551. Dphthn_synthase. [Graphical view] |
| Pfam | PF00590. TP_methylase. 1 hit. [Graphical view] |
| PIRSF | PIRSF036432. Diphthine_synth. 1 hit. |
| SUPFAM | SSF53790. Cor/por_Metransf. 1 hit. |
| TIGRFAMs | TIGR00522. dph5. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | DPH5. human. |
| GenomeRNAi | 51611. |
| NextBio | 55510. |
| SOURCE | Search... |
Entry information
| Entry name | DPH5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H2P9 Secondary accession number(s): A8JZY6 Q9Y319 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
