SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9H2P9

- DPH5_HUMAN

UniProt

Q9H2P9 - DPH5_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Diphthine synthase

Gene
DPH5, AD-018, CGI-30, HSPC143, NPD015
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the trimethylation of the amino group of the modified target histidine residue in translation elongation factor 2 (EEF2), to form an intermediate called diphthine. The three successive methylation reactions represent the second step of diphthamide biosynthesis.1 Publication

Catalytic activityi

3 S-adenosyl-L-methionine + 2-(3-carboxy-3-aminopropyl)-L-histidine-[translation elongation factor 2] = 3 S-adenosyl-L-homocysteine + 2-(3-carboxy-3-(trimethylammonio)propyl)-L-histidine-[translation elongation factor 2].UniRule annotation

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei9 – 91S-adenosyl-L-methionine; via carbonyl oxygen By similarity
Binding sitei84 – 841S-adenosyl-L-methionine; via amide nitrogen and carbonyl oxygen By similarity
Binding sitei87 – 871S-adenosyl-L-methionine; via carbonyl oxygen By similarity
Binding sitei163 – 1631S-adenosyl-L-methionine; via amide nitrogen and carbonyl oxygen By similarity
Binding sitei225 – 2251S-adenosyl-L-methionine; via amide nitrogen and carbonyl oxygen By similarity
Binding sitei250 – 2501S-adenosyl-L-methionine; via carbonyl oxygen By similarity

GO - Molecular functioni

  1. diphthine synthase activity Source: UniProtKB

GO - Biological processi

  1. peptidyl-diphthamide biosynthetic process from peptidyl-histidine Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Methyltransferase, Transferase

Keywords - Ligandi

S-adenosyl-L-methionine

Enzyme and pathway databases

UniPathwayiUPA00559.

Names & Taxonomyi

Protein namesi
Recommended name:
Diphthine synthase (EC:2.1.1.98)
Alternative name(s):
Diphthamide biosynthesis methyltransferase
Gene namesi
Name:DPH5
ORF Names:AD-018, CGI-30, HSPC143, NPD015
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:24270. DPH5.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671956.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 285285Diphthine synthaseUniRule annotationPRO_0000156133Add
BLAST

Proteomic databases

MaxQBiQ9H2P9.
PaxDbiQ9H2P9.
PRIDEiQ9H2P9.

PTM databases

PhosphoSiteiQ9H2P9.

Expressioni

Gene expression databases

ArrayExpressiQ9H2P9.
BgeeiQ9H2P9.
CleanExiHS_DPH5.
GenevestigatoriQ9H2P9.

Organism-specific databases

HPAiHPA046439.

Interactioni

Protein-protein interaction databases

BioGridi119637. 1 interaction.
STRINGi9606.ENSP00000359127.

Structurei

3D structure databases

ProteinModelPortaliQ9H2P9.
SMRiQ9H2P9. Positions 1-270.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni112 – 1132S-adenosyl-L-methionine binding By similarity

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG1798.
HOGENOMiHOG000205302.
HOVERGENiHBG044879.
InParanoidiQ9H2P9.
KOiK00586.
OMAiQQMCTVD.
OrthoDBiEOG7Q2N64.
PhylomeDBiQ9H2P9.
TreeFamiTF105603.

Family and domain databases

Gene3Di3.30.950.10. 1 hit.
3.40.1010.10. 1 hit.
HAMAPiMF_01084. Diphthine_synth.
InterProiIPR000878. 4pyrrol_Mease.
IPR014777. 4pyrrole_Mease_sub1.
IPR014776. 4pyrrole_Mease_sub2.
IPR004551. Dphthn_synthase.
[Graphical view]
PfamiPF00590. TP_methylase. 1 hit.
[Graphical view]
PIRSFiPIRSF036432. Diphthine_synth. 1 hit.
SUPFAMiSSF53790. SSF53790. 1 hit.
TIGRFAMsiTIGR00522. dph5. 1 hit.

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9H2P9-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MLYLIGLGLG DAKDITVKGL EVVRRCSRVY LEAYTSVLTV GKEALEEFYG    50
RKLVVADREE VEQEADNILK DADISDVAFL VVGDPFGATT HSDLVLRATK 100
LGIPYRVIHN ASIMNAVGCC GLQLYKFGET VSIVFWTDTW RPESFFDKVK 150
KNRQNGMHTL CLLDIKVKEQ SLENLIKGRK IYEPPRYMSV NQAAQQLLEI 200
VQNQRIRGEE PAVTEETLCV GLARVGADDQ KIAAGTLRQM CTVDLGEPLH 250
SLIITGGSIH PMEMEMLSLF SIPENSSESQ SINGL 285
Length:285
Mass (Da):31,651
Last modified:October 10, 2003 - v2
Checksum:i1348631C25BC624E
GO
Isoform 2 (identifier: Q9H2P9-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     85-137: PFGATTHSDLVLRATKLGIPYRVIHNASIMNAVGCCGLQLYKFGETVSIVFWT → HL

Note: No experimental confirmation available.

Show »
Length:234
Mass (Da):26,122
Checksum:iCAA1ABE0A11AF714
GO
Isoform 3 (identifier: Q9H2P9-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-143: ATTHSDLVLRATKLGIPYRVIHNASIMNAVGCCGLQLYKFGETVSIVFWTDTWRPE → HLETR

Note: No experimental confirmation available.

Show »
Length:234
Mass (Da):26,025
Checksum:i86A9E6761145DFBA
GO
Isoform 4 (identifier: Q9H2P9-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     117-141: VGCCGLQLYKFGETVSIVFWTDTWR → EAAGGYRYISLERQVLLVFGQTLGG

Note: No experimental confirmation available.

Show »
Length:285
Mass (Da):31,440
Checksum:i2784D835EB96EFC2
GO
Isoform 5 (identifier: Q9H2P9-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     134-137: VFWT → MLISVMLHSLWLVIHL

Note: No experimental confirmation available.

Show »
Length:297
Mass (Da):33,005
Checksum:iE0D27EEEF0B9849D
GO
Isoform 6 (identifier: Q9H2P9-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     212-212: Missing.

Note: No experimental confirmation available.

Show »
Length:284
Mass (Da):31,580
Checksum:i862A9762E32AA574
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei85 – 13753PFGAT…IVFWT → HL in isoform 2. VSP_008508Add
BLAST
Alternative sequencei88 – 14356ATTHS…TWRPE → HLETR in isoform 3. VSP_008509Add
BLAST
Alternative sequencei117 – 14125VGCCG…TDTWR → EAAGGYRYISLERQVLLVFG QTLGG in isoform 4. VSP_008510Add
BLAST
Alternative sequencei134 – 1374VFWT → MLISVMLHSLWLVIHL in isoform 5. VSP_008511
Alternative sequencei212 – 2121Missing in isoform 6. VSP_043444

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti107 – 1071V → G in AAG44563. 1 Publication
Sequence conflicti285 – 2851L → FEHRYFHCLM in AAF67485. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF132964 mRNA. Translation: AAD27739.1.
AF157319 mRNA. Translation: AAF67485.1.
AF161492 mRNA. Translation: AAF29107.1.
AF248965 mRNA. Translation: AAG44563.1.
AK289351 mRNA. Translation: BAF82040.1.
AC093157 Genomic DNA. No translation available.
CH471097 Genomic DNA. Translation: EAW72933.1.
CH471097 Genomic DNA. Translation: EAW72937.1.
CH471097 Genomic DNA. Translation: EAW72938.1.
CH471097 Genomic DNA. Translation: EAW72940.1.
BC053857 mRNA. Translation: AAH53857.1.
CCDSiCCDS41358.1. [Q9H2P9-1]
CCDS41359.1. [Q9H2P9-6]
RefSeqiNP_001070862.1. NM_001077394.1. [Q9H2P9-1]
NP_001070863.1. NM_001077395.1. [Q9H2P9-6]
NP_057042.2. NM_015958.2. [Q9H2P9-1]
UniGeneiHs.440776.

Genome annotation databases

EnsembliENST00000342173; ENSP00000339630; ENSG00000117543. [Q9H2P9-6]
ENST00000370109; ENSP00000359127; ENSG00000117543. [Q9H2P9-1]
ENST00000488176; ENSP00000418282; ENSG00000117543. [Q9H2P9-1]
GeneIDi51611.
KEGGihsa:51611.
UCSCiuc001dtr.2. human. [Q9H2P9-6]
uc001dts.2. human. [Q9H2P9-1]
uc001dty.2. human. [Q9H2P9-5]

Polymorphism databases

DMDMi46397414.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF132964 mRNA. Translation: AAD27739.1 .
AF157319 mRNA. Translation: AAF67485.1 .
AF161492 mRNA. Translation: AAF29107.1 .
AF248965 mRNA. Translation: AAG44563.1 .
AK289351 mRNA. Translation: BAF82040.1 .
AC093157 Genomic DNA. No translation available.
CH471097 Genomic DNA. Translation: EAW72933.1 .
CH471097 Genomic DNA. Translation: EAW72937.1 .
CH471097 Genomic DNA. Translation: EAW72938.1 .
CH471097 Genomic DNA. Translation: EAW72940.1 .
BC053857 mRNA. Translation: AAH53857.1 .
CCDSi CCDS41358.1. [Q9H2P9-1 ]
CCDS41359.1. [Q9H2P9-6 ]
RefSeqi NP_001070862.1. NM_001077394.1. [Q9H2P9-1 ]
NP_001070863.1. NM_001077395.1. [Q9H2P9-6 ]
NP_057042.2. NM_015958.2. [Q9H2P9-1 ]
UniGenei Hs.440776.

3D structure databases

ProteinModelPortali Q9H2P9.
SMRi Q9H2P9. Positions 1-270.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119637. 1 interaction.
STRINGi 9606.ENSP00000359127.

PTM databases

PhosphoSitei Q9H2P9.

Polymorphism databases

DMDMi 46397414.

Proteomic databases

MaxQBi Q9H2P9.
PaxDbi Q9H2P9.
PRIDEi Q9H2P9.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000342173 ; ENSP00000339630 ; ENSG00000117543 . [Q9H2P9-6 ]
ENST00000370109 ; ENSP00000359127 ; ENSG00000117543 . [Q9H2P9-1 ]
ENST00000488176 ; ENSP00000418282 ; ENSG00000117543 . [Q9H2P9-1 ]
GeneIDi 51611.
KEGGi hsa:51611.
UCSCi uc001dtr.2. human. [Q9H2P9-6 ]
uc001dts.2. human. [Q9H2P9-1 ]
uc001dty.2. human. [Q9H2P9-5 ]

Organism-specific databases

CTDi 51611.
GeneCardsi GC01M101455.
H-InvDB HIX0023161.
HGNCi HGNC:24270. DPH5.
HPAi HPA046439.
MIMi 611075. gene.
neXtProti NX_Q9H2P9.
PharmGKBi PA142671956.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1798.
HOGENOMi HOG000205302.
HOVERGENi HBG044879.
InParanoidi Q9H2P9.
KOi K00586.
OMAi QQMCTVD.
OrthoDBi EOG7Q2N64.
PhylomeDBi Q9H2P9.
TreeFami TF105603.

Enzyme and pathway databases

UniPathwayi UPA00559 .

Miscellaneous databases

ChiTaRSi DPH5. human.
GeneWikii DPH5.
GenomeRNAii 51611.
NextBioi 55510.
PROi Q9H2P9.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9H2P9.
Bgeei Q9H2P9.
CleanExi HS_DPH5.
Genevestigatori Q9H2P9.

Family and domain databases

Gene3Di 3.30.950.10. 1 hit.
3.40.1010.10. 1 hit.
HAMAPi MF_01084. Diphthine_synth.
InterProi IPR000878. 4pyrrol_Mease.
IPR014777. 4pyrrole_Mease_sub1.
IPR014776. 4pyrrole_Mease_sub2.
IPR004551. Dphthn_synthase.
[Graphical view ]
Pfami PF00590. TP_methylase. 1 hit.
[Graphical view ]
PIRSFi PIRSF036432. Diphthine_synth. 1 hit.
SUPFAMi SSF53790. SSF53790. 1 hit.
TIGRFAMsi TIGR00522. dph5. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics."
    Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C.
    Genome Res. 10:703-713(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Adrenal gland.
  3. "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
    Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X.
    , Gu J., Chen S.-J., Chen Z.
    Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Umbilical cord blood.
  4. Yang Y., Xu X., Gao G., Xiao H., Chen Z., Han Z.
    Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Pituitary.
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
  6. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Eye.
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. "A modified form of diphthamide causes immunotoxin resistance in a lymphoma cell line with a deletion of the WDR85 gene."
    Wei H., Bera T.K., Wayne A.S., Xiang L., Colantonio S., Chertov O., Pastan I.
    J. Biol. Chem. 288:12305-12312(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN DIPHTHAMIDE BIOSYNTHESIS.

Entry informationi

Entry nameiDPH5_HUMAN
AccessioniPrimary (citable) accession number: Q9H2P9
Secondary accession number(s): A8JZY6
, D3DT62, Q9P017, Q9P0I4, Q9Y319
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 10, 2003
Last sequence update: October 10, 2003
Last modified: July 9, 2014
This is version 105 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi