Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium-dependent neutral amino acid transporter B(0)AT2

Gene

SLC6A15

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Functions as a sodium-dependent neutral amino acid transporter. Exhibits preference for the branched-chain amino acids, particularly leucine, valine and isoleucine and methionine. Mediates the saturable, pH-sensitive and electrogenic cotransport of proline and sodium ions with a stoichiometry of 1:1. May have a role as transporter for neurotransmitter precursors into neurons. In contrast to other members of the neurotransmitter transporter family, does not appear to be chloride-dependent.1 Publication

Kineticsi

  1. KM=0.16 mM for L-leucine (at pH 7.5, 100 mM NaCL, -70 mV)1 Publication
  2. KM=0.16 mM for L-valine (at pH 7.5, 100 mM NaCL, -70 mV))1 Publication
  3. KM=0.08 mM for L-isoleucine (at pH 7.5, 100 mM NaCL, -70 mV)1 Publication
  4. KM=0.11 mM for L-methionine (at pH 7.5, 100 mM NaCL, -70 mV)1 Publication
  5. KM=0.38 mM for L-proline (at pH 7.5, 100 mM NaCL, -70 mV)1 Publication

    pH dependencei

    Optimum pH is 7.5-8.5. Strongly inhibited at acidic PH.1 Publication

    GO - Molecular functioni

    GO - Biological processi

    • amino acid transport Source: Reactome
    • ion transport Source: Reactome
    • leucine transport Source: UniProtKB
    • neurotransmitter transport Source: UniProtKB
    • neutral amino acid transport Source: UniProtKB
    • proline transport Source: UniProtKB
    • transmembrane transport Source: Reactome
    Complete GO annotation...

    Keywords - Biological processi

    Amino-acid transport, Ion transport, Neurotransmitter transport, Sodium transport, Symport, Transport

    Keywords - Ligandi

    Sodium

    Enzyme and pathway databases

    ReactomeiREACT_13796. Amino acid transport across the plasma membrane.
    REACT_20506. Na+/Cl- dependent neurotransmitter transporters.

    Protein family/group databases

    TCDBi2.A.22.6.7. the neurotransmitter:sodium symporter (nss) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sodium-dependent neutral amino acid transporter B(0)AT2
    Alternative name(s):
    Sodium- and chloride-dependent neurotransmitter transporter NTT73
    Sodium-coupled branched-chain amino-acid transporter 1
    Solute carrier family 6 member 15
    Transporter v7-3
    Gene namesi
    Name:SLC6A15
    Synonyms:B0AT2, NTT73, SBAT1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640 Componenti: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:13621. SLC6A15.

    Subcellular locationi

    Topology

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 6969CytoplasmicSequence AnalysisAdd
    BLAST
    Transmembranei70 – 9021Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei98 – 11720Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei142 – 16221Helical; Name=3Sequence AnalysisAdd
    BLAST
    Topological domaini163 – 22563ExtracellularSequence AnalysisAdd
    BLAST
    Transmembranei226 – 24419Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei253 – 27018Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei306 – 32318Helical; Name=6Sequence AnalysisAdd
    BLAST
    Transmembranei335 – 35622Helical; Name=7Sequence AnalysisAdd
    BLAST
    Topological domaini357 – 45296ExtracellularSequence AnalysisAdd
    BLAST
    Transmembranei453 – 47220Helical; Name=8Sequence AnalysisAdd
    BLAST
    Transmembranei496 – 51419Helical; Name=9Sequence AnalysisAdd
    BLAST
    Transmembranei530 – 55021Helical; Name=10Sequence AnalysisAdd
    BLAST
    Transmembranei571 – 59222Helical; Name=11Sequence AnalysisAdd
    BLAST
    Transmembranei620 – 64223Helical; Name=12Sequence AnalysisAdd
    BLAST
    Topological domaini643 – 73088CytoplasmicSequence AnalysisAdd
    BLAST

    GO - Cellular componenti

    • integral component of membrane Source: UniProtKB
    • integral component of plasma membrane Source: InterPro
    • plasma membrane Source: Reactome
    Complete GO annotation...

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA37799.

    Polymorphism and mutation databases

    BioMutaiSLC6A15.
    DMDMi18202939.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 730730Sodium-dependent neutral amino acid transporter B(0)AT2PRO_0000214798Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei55 – 551Phosphoserine1 Publication
    Glycosylationi187 – 1871N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi213 – 2131N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi383 – 3831N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi394 – 3941N-linked (GlcNAc...)Sequence Analysis
    Modified residuei687 – 6871Phosphoserine1 Publication

    Keywords - PTMi

    Glycoprotein, Phosphoprotein

    Proteomic databases

    MaxQBiQ9H2J7.
    PaxDbiQ9H2J7.
    PRIDEiQ9H2J7.

    PTM databases

    PhosphoSiteiQ9H2J7.

    Expressioni

    Tissue specificityi

    Almost exclusively expressed in the brain.1 Publication

    Gene expression databases

    BgeeiQ9H2J7.
    CleanExiHS_SLC6A15.
    ExpressionAtlasiQ9H2J7. baseline and differential.
    GenevisibleiQ9H2J7. HS.

    Organism-specific databases

    HPAiHPA008609.

    Interactioni

    Protein-protein interaction databases

    BioGridi120426. 2 interactions.
    STRINGi9606.ENSP00000266682.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9H2J7.
    SMRiQ9H2J7. Positions 59-363, 435-637.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0733.
    GeneTreeiENSGT00760000119044.
    HOGENOMiHOG000116406.
    HOVERGENiHBG071421.
    InParanoidiQ9H2J7.
    KOiK05048.
    OMAiAWVVVCL.
    OrthoDBiEOG793B71.
    PhylomeDBiQ9H2J7.
    TreeFamiTF352709.

    Family and domain databases

    InterProiIPR000175. Na/ntran_symport.
    IPR002438. Na/ntran_symport_orphan.
    [Graphical view]
    PANTHERiPTHR11616. PTHR11616. 1 hit.
    PfamiPF00209. SNF. 1 hit.
    [Graphical view]
    PRINTSiPR00176. NANEUSMPORT.
    PR01206. ORPHTRNSPORT.
    PROSITEiPS00610. NA_NEUROTRAN_SYMP_1. 1 hit.
    PS00754. NA_NEUROTRAN_SYMP_2. 1 hit.
    PS50267. NA_NEUROTRAN_SYMP_3. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

    Isoform 1 (identifier: Q9H2J7-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

            10         20         30         40         50
    MPKNSKVVKR ELDDDVTESV KDLLSNEDAA DDAFKTSELI VDGQEEKDTD
    60 70 80 90 100
    VEEGSEVEDE RPAWNSKLQY ILAQVGFSVG LGNVWRFPYL CQKNGGGAYL
    110 120 130 140 150
    LPYLILLMVI GIPLFFLELS VGQRIRRGSI GVWNYISPKL GGIGFASCVV
    160 170 180 190 200
    CYFVALYYNV IIGWSLFYFS QSFQQPLPWD QCPLVKNASH TFVEPECEQS
    210 220 230 240 250
    SATTYYWYRE ALNISSSISE SGGLNWKMTI CLLAAWVMVC LAMIKGIQSS
    260 270 280 290 300
    GKIIYFSSLF PYVVLICFLI RAFLLNGSID GIRHMFTPKL EIMLEPKVWR
    310 320 330 340 350
    EAATQVFFAL GLGFGGVIAF SSYNKRDNNC HFDAVLVSFI NFFTSVLATL
    360 370 380 390 400
    VVFAVLGFKA NVINEKCITQ NSETIMKFLK MGNISQDIIP HHINLSTVTA
    410 420 430 440 450
    EDYHLVYDII QKVKEEEFPA LHLNSCKIEE ELNKAVQGTG LAFIAFTEAM
    460 470 480 490 500
    THFPASPFWS VMFFLMLVNL GLGSMFGTIE GIVTPIVDTF KVRKEILTVI
    510 520 530 540 550
    CCLLAFCIGL IFVQRSGNYF VTMFDDYSAT LPLLIVVILE NIAVCFVYGI
    560 570 580 590 600
    DKFMEDLKDM LGFAPSRYYY YMWKYISPLM LLSLLIASVV NMGLSPPGYN
    610 620 630 640 650
    AWIEDKASEE FLSYPTWGLV VCVSLVVFAI LPVPVVFIVR RFNLIDDSSG
    660 670 680 690 700
    NLASVTYKRG RVLKEPVNLE GDDTSLIHGK IPSEMPSPNF GKNIYRKQSG
    710 720 730
    SPTLDTAPNG RYGIGYLMAD IMPDMPESDL
    Length:730
    Mass (Da):81,836
    Last modified:March 1, 2001 - v1
    Checksum:i45963118E06CFFE6
    GO
    Isoform 2 (identifier: Q9H2J7-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         253-289: IIYFSSLFPYVVLICFLIRAFLLNGSIDGIRHMFTPK → VSMLEPFLILLITISGFIPLSNSVTDFCGQITHNTSF
         290-730: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:289
    Mass (Da):32,264
    Checksum:iAB0768CD8F74BF47
    GO
    Isoform 3 (identifier: Q9H2J7-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-107: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:623
    Mass (Da):69,886
    Checksum:iDB10A517144B0643
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti400 – 4001A → V.1 Publication
    Corresponds to variant rs12424429 [ dbSNP | Ensembl ].
    VAR_052065
    Natural varianti603 – 6031I → M.
    Corresponds to variant rs3782369 [ dbSNP | Ensembl ].
    VAR_052066

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 107107Missing in isoform 3. 1 PublicationVSP_045192Add
    BLAST
    Alternative sequencei253 – 28937IIYFS…MFTPK → VSMLEPFLILLITISGFIPL SNSVTDFCGQITHNTSF in isoform 2. 1 PublicationVSP_043030Add
    BLAST
    Alternative sequencei290 – 730441Missing in isoform 2. 1 PublicationVSP_043031Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AF265577 mRNA. Translation: AAG41361.1.
    AK022853 mRNA. Translation: BAB14274.1.
    AK291207 mRNA. Translation: BAF83896.1.
    AK294945 mRNA. Translation: BAH11933.1.
    AC018922 Genomic DNA. No translation available.
    AC128657 Genomic DNA. No translation available.
    CH471054 Genomic DNA. Translation: EAW97389.1.
    BC070040 mRNA. Translation: AAH70040.1.
    CCDSiCCDS53816.1. [Q9H2J7-3]
    CCDS9026.1. [Q9H2J7-1]
    CCDS9027.1. [Q9H2J7-2]
    RefSeqiNP_001139807.1. NM_001146335.2. [Q9H2J7-3]
    NP_060527.2. NM_018057.6. [Q9H2J7-2]
    NP_877499.1. NM_182767.5. [Q9H2J7-1]
    XP_011536825.1. XM_011538523.1. [Q9H2J7-1]
    UniGeneiHs.44424.

    Genome annotation databases

    EnsembliENST00000266682; ENSP00000266682; ENSG00000072041.
    ENST00000450363; ENSP00000390706; ENSG00000072041. [Q9H2J7-2]
    ENST00000552192; ENSP00000450145; ENSG00000072041. [Q9H2J7-3]
    GeneIDi55117.
    KEGGihsa:55117.
    UCSCiuc001szv.4. human. [Q9H2J7-1]
    uc001szy.4. human. [Q9H2J7-2]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AF265577 mRNA. Translation: AAG41361.1.
    AK022853 mRNA. Translation: BAB14274.1.
    AK291207 mRNA. Translation: BAF83896.1.
    AK294945 mRNA. Translation: BAH11933.1.
    AC018922 Genomic DNA. No translation available.
    AC128657 Genomic DNA. No translation available.
    CH471054 Genomic DNA. Translation: EAW97389.1.
    BC070040 mRNA. Translation: AAH70040.1.
    CCDSiCCDS53816.1. [Q9H2J7-3]
    CCDS9026.1. [Q9H2J7-1]
    CCDS9027.1. [Q9H2J7-2]
    RefSeqiNP_001139807.1. NM_001146335.2. [Q9H2J7-3]
    NP_060527.2. NM_018057.6. [Q9H2J7-2]
    NP_877499.1. NM_182767.5. [Q9H2J7-1]
    XP_011536825.1. XM_011538523.1. [Q9H2J7-1]
    UniGeneiHs.44424.

    3D structure databases

    ProteinModelPortaliQ9H2J7.
    SMRiQ9H2J7. Positions 59-363, 435-637.
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi120426. 2 interactions.
    STRINGi9606.ENSP00000266682.

    Protein family/group databases

    TCDBi2.A.22.6.7. the neurotransmitter:sodium symporter (nss) family.

    PTM databases

    PhosphoSiteiQ9H2J7.

    Polymorphism and mutation databases

    BioMutaiSLC6A15.
    DMDMi18202939.

    Proteomic databases

    MaxQBiQ9H2J7.
    PaxDbiQ9H2J7.
    PRIDEiQ9H2J7.

    Protocols and materials databases

    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000266682; ENSP00000266682; ENSG00000072041.
    ENST00000450363; ENSP00000390706; ENSG00000072041. [Q9H2J7-2]
    ENST00000552192; ENSP00000450145; ENSG00000072041. [Q9H2J7-3]
    GeneIDi55117.
    KEGGihsa:55117.
    UCSCiuc001szv.4. human. [Q9H2J7-1]
    uc001szy.4. human. [Q9H2J7-2]

    Organism-specific databases

    CTDi55117.
    GeneCardsiGC12M085253.
    HGNCiHGNC:13621. SLC6A15.
    HPAiHPA008609.
    MIMi607971. gene.
    neXtProtiNX_Q9H2J7.
    PharmGKBiPA37799.
    GenAtlasiSearch...

    Phylogenomic databases

    eggNOGiCOG0733.
    GeneTreeiENSGT00760000119044.
    HOGENOMiHOG000116406.
    HOVERGENiHBG071421.
    InParanoidiQ9H2J7.
    KOiK05048.
    OMAiAWVVVCL.
    OrthoDBiEOG793B71.
    PhylomeDBiQ9H2J7.
    TreeFamiTF352709.

    Enzyme and pathway databases

    ReactomeiREACT_13796. Amino acid transport across the plasma membrane.
    REACT_20506. Na+/Cl- dependent neurotransmitter transporters.

    Miscellaneous databases

    ChiTaRSiSLC6A15. human.
    GeneWikiiSLC6A15.
    GenomeRNAii55117.
    NextBioi58754.
    PROiQ9H2J7.
    SOURCEiSearch...

    Gene expression databases

    BgeeiQ9H2J7.
    CleanExiHS_SLC6A15.
    ExpressionAtlasiQ9H2J7. baseline and differential.
    GenevisibleiQ9H2J7. HS.

    Family and domain databases

    InterProiIPR000175. Na/ntran_symport.
    IPR002438. Na/ntran_symport_orphan.
    [Graphical view]
    PANTHERiPTHR11616. PTHR11616. 1 hit.
    PfamiPF00209. SNF. 1 hit.
    [Graphical view]
    PRINTSiPR00176. NANEUSMPORT.
    PR01206. ORPHTRNSPORT.
    PROSITEiPS00610. NA_NEUROTRAN_SYMP_1. 1 hit.
    PS00754. NA_NEUROTRAN_SYMP_2. 1 hit.
    PS50267. NA_NEUROTRAN_SYMP_3. 1 hit.
    [Graphical view]
    ProtoNetiSearch...

    Publicationsi

    « Hide 'large scale' publications
    1. "Cloning and characterization of human NTT5 and v7-3: two orphan transporters of the Na(+)/Cl(-)-dependent neurotransmitter transporter gene family."
      Farmer M.K., Robbins M.J., Medhurst A.D., Campbell D.A., Ellington K., Duckworth M., Brown A.M., Middlemiss D.N., Price G.W., Pangalos M.N.
      Genomics 70:241-252(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Cerebellum.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), VARIANT VAL-400.
      Tissue: Brain.
    3. "The finished DNA sequence of human chromosome 12."
      Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
      , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
      Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Placenta.
    6. "Characterization of a branched-chain amino-acid transporter SBAT1 (SLC6A15) that is expressed in human brain."
      Takanaga H., Mackenzie B., Peng J.B., Hediger M.A.
      Biochem. Biophys. Res. Commun. 337:892-900(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY, FUNCTION, BIOPHYSICOCHEMICAL PROPERTIES.
    7. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-55 AND SER-687, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    10. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiS6A15_HUMAN
    AccessioniPrimary (citable) accession number: Q9H2J7
    Secondary accession number(s): A8K592
    , B7Z2P7, E7ESJ5, Q9H9F5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 26, 2001
    Last sequence update: March 1, 2001
    Last modified: July 22, 2015
    This is version 122 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3

    Similar proteinsi

    Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
    100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
    90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
    50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.