Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9H2J7

- S6A15_HUMAN

UniProt

Q9H2J7 - S6A15_HUMAN

Protein

Sodium-dependent neutral amino acid transporter B(0)AT2

Gene

SLC6A15

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 115 (01 Oct 2014)
      Sequence version 1 (01 Mar 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Functions as a sodium-dependent neutral amino acid transporter. Exhibits preference for the branched-chain amino acids, particularly leucine, valine and isoleucine and methionine. Mediates the saturable, pH-sensitive and electrogenic cotransport of proline and sodium ions with a stoichiometry of 1:1. May have a role as transporter for neurotransmitter precursors into neurons. In contrast to other members of the neurotransmitter transporter family, does not appear to be chloride-dependent.1 Publication

    Kineticsi

    1. KM=0.16 mM for L-leucine (at pH 7.5, 100 mM NaCL, -70 mV)1 Publication
    2. KM=0.16 mM for L-valine (at pH 7.5, 100 mM NaCL, -70 mV))1 Publication
    3. KM=0.08 mM for L-isoleucine (at pH 7.5, 100 mM NaCL, -70 mV)1 Publication
    4. KM=0.11 mM for L-methionine (at pH 7.5, 100 mM NaCL, -70 mV)1 Publication
    5. KM=0.38 mM for L-proline (at pH 7.5, 100 mM NaCL, -70 mV)1 Publication

    pH dependencei

    Optimum pH is 7.5-8.5. Strongly inhibited at acidic PH.1 Publication

    GO - Molecular functioni

    1. neurotransmitter:sodium symporter activity Source: InterPro
    2. neurotransmitter transporter activity Source: UniProtKB
    3. proline:sodium symporter activity Source: Ensembl

    GO - Biological processi

    1. amino acid transport Source: Reactome
    2. ion transport Source: Reactome
    3. leucine transport Source: UniProtKB
    4. neurotransmitter transport Source: UniProtKB
    5. neutral amino acid transport Source: UniProtKB
    6. proline transport Source: UniProtKB
    7. transmembrane transport Source: Reactome

    Keywords - Biological processi

    Amino-acid transport, Ion transport, Neurotransmitter transport, Sodium transport, Symport, Transport

    Keywords - Ligandi

    Sodium

    Enzyme and pathway databases

    ReactomeiREACT_13796. Amino acid transport across the plasma membrane.
    REACT_20506. Na+/Cl- dependent neurotransmitter transporters.

    Protein family/group databases

    TCDBi2.A.22.6.7. the neurotransmitter:sodium symporter (nss) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sodium-dependent neutral amino acid transporter B(0)AT2
    Alternative name(s):
    Sodium- and chloride-dependent neurotransmitter transporter NTT73
    Sodium-coupled branched-chain amino-acid transporter 1
    Solute carrier family 6 member 15
    Transporter v7-3
    Gene namesi
    Name:SLC6A15
    Synonyms:B0AT2, NTT73, SBAT1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:13621. SLC6A15.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB
    2. integral component of plasma membrane Source: InterPro
    3. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA37799.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 730730Sodium-dependent neutral amino acid transporter B(0)AT2PRO_0000214798Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei55 – 551Phosphoserine1 Publication
    Glycosylationi187 – 1871N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi213 – 2131N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi383 – 3831N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi394 – 3941N-linked (GlcNAc...)Sequence Analysis
    Modified residuei687 – 6871Phosphoserine1 Publication

    Keywords - PTMi

    Glycoprotein, Phosphoprotein

    Proteomic databases

    MaxQBiQ9H2J7.
    PaxDbiQ9H2J7.
    PRIDEiQ9H2J7.

    PTM databases

    PhosphoSiteiQ9H2J7.

    Expressioni

    Tissue specificityi

    Almost exclusively expressed in the brain.1 Publication

    Gene expression databases

    ArrayExpressiQ9H2J7.
    BgeeiQ9H2J7.
    CleanExiHS_SLC6A15.
    GenevestigatoriQ9H2J7.

    Organism-specific databases

    HPAiHPA008609.

    Interactioni

    Protein-protein interaction databases

    BioGridi120426. 2 interactions.
    STRINGi9606.ENSP00000266682.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9H2J7.
    SMRiQ9H2J7. Positions 59-363, 435-637.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 6969CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini163 – 22563ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini357 – 45296ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini643 – 73088CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei70 – 9021Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei98 – 11720Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei142 – 16221Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei226 – 24419Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei253 – 27018Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei306 – 32318Helical; Name=6Sequence AnalysisAdd
    BLAST
    Transmembranei335 – 35622Helical; Name=7Sequence AnalysisAdd
    BLAST
    Transmembranei453 – 47220Helical; Name=8Sequence AnalysisAdd
    BLAST
    Transmembranei496 – 51419Helical; Name=9Sequence AnalysisAdd
    BLAST
    Transmembranei530 – 55021Helical; Name=10Sequence AnalysisAdd
    BLAST
    Transmembranei571 – 59222Helical; Name=11Sequence AnalysisAdd
    BLAST
    Transmembranei620 – 64223Helical; Name=12Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0733.
    HOGENOMiHOG000116406.
    HOVERGENiHBG071421.
    InParanoidiQ9H2J7.
    KOiK05048.
    OMAiTPKLEMM.
    OrthoDBiEOG793B71.
    PhylomeDBiQ9H2J7.
    TreeFamiTF352709.

    Family and domain databases

    InterProiIPR000175. Na/ntran_symport.
    IPR002438. Na/ntran_symport_orphan.
    [Graphical view]
    PANTHERiPTHR11616. PTHR11616. 1 hit.
    PfamiPF00209. SNF. 1 hit.
    [Graphical view]
    PRINTSiPR00176. NANEUSMPORT.
    PR01206. ORPHTRNSPORT.
    PROSITEiPS00610. NA_NEUROTRAN_SYMP_1. 1 hit.
    PS00754. NA_NEUROTRAN_SYMP_2. 1 hit.
    PS50267. NA_NEUROTRAN_SYMP_3. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9H2J7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPKNSKVVKR ELDDDVTESV KDLLSNEDAA DDAFKTSELI VDGQEEKDTD    50
    VEEGSEVEDE RPAWNSKLQY ILAQVGFSVG LGNVWRFPYL CQKNGGGAYL 100
    LPYLILLMVI GIPLFFLELS VGQRIRRGSI GVWNYISPKL GGIGFASCVV 150
    CYFVALYYNV IIGWSLFYFS QSFQQPLPWD QCPLVKNASH TFVEPECEQS 200
    SATTYYWYRE ALNISSSISE SGGLNWKMTI CLLAAWVMVC LAMIKGIQSS 250
    GKIIYFSSLF PYVVLICFLI RAFLLNGSID GIRHMFTPKL EIMLEPKVWR 300
    EAATQVFFAL GLGFGGVIAF SSYNKRDNNC HFDAVLVSFI NFFTSVLATL 350
    VVFAVLGFKA NVINEKCITQ NSETIMKFLK MGNISQDIIP HHINLSTVTA 400
    EDYHLVYDII QKVKEEEFPA LHLNSCKIEE ELNKAVQGTG LAFIAFTEAM 450
    THFPASPFWS VMFFLMLVNL GLGSMFGTIE GIVTPIVDTF KVRKEILTVI 500
    CCLLAFCIGL IFVQRSGNYF VTMFDDYSAT LPLLIVVILE NIAVCFVYGI 550
    DKFMEDLKDM LGFAPSRYYY YMWKYISPLM LLSLLIASVV NMGLSPPGYN 600
    AWIEDKASEE FLSYPTWGLV VCVSLVVFAI LPVPVVFIVR RFNLIDDSSG 650
    NLASVTYKRG RVLKEPVNLE GDDTSLIHGK IPSEMPSPNF GKNIYRKQSG 700
    SPTLDTAPNG RYGIGYLMAD IMPDMPESDL 730
    Length:730
    Mass (Da):81,836
    Last modified:March 1, 2001 - v1
    Checksum:i45963118E06CFFE6
    GO
    Isoform 2 (identifier: Q9H2J7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         253-289: IIYFSSLFPYVVLICFLIRAFLLNGSIDGIRHMFTPK → VSMLEPFLILLITISGFIPLSNSVTDFCGQITHNTSF
         290-730: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:289
    Mass (Da):32,264
    Checksum:iAB0768CD8F74BF47
    GO
    Isoform 3 (identifier: Q9H2J7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-107: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:623
    Mass (Da):69,886
    Checksum:iDB10A517144B0643
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti400 – 4001A → V.1 Publication
    Corresponds to variant rs12424429 [ dbSNP | Ensembl ].
    VAR_052065
    Natural varianti603 – 6031I → M.
    Corresponds to variant rs3782369 [ dbSNP | Ensembl ].
    VAR_052066

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 107107Missing in isoform 3. 1 PublicationVSP_045192Add
    BLAST
    Alternative sequencei253 – 28937IIYFS…MFTPK → VSMLEPFLILLITISGFIPL SNSVTDFCGQITHNTSF in isoform 2. 1 PublicationVSP_043030Add
    BLAST
    Alternative sequencei290 – 730441Missing in isoform 2. 1 PublicationVSP_043031Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF265577 mRNA. Translation: AAG41361.1.
    AK022853 mRNA. Translation: BAB14274.1.
    AK291207 mRNA. Translation: BAF83896.1.
    AK294945 mRNA. Translation: BAH11933.1.
    AC018922 Genomic DNA. No translation available.
    AC128657 Genomic DNA. No translation available.
    CH471054 Genomic DNA. Translation: EAW97389.1.
    BC070040 mRNA. Translation: AAH70040.1.
    CCDSiCCDS53816.1. [Q9H2J7-3]
    CCDS9026.1. [Q9H2J7-1]
    CCDS9027.1. [Q9H2J7-2]
    RefSeqiNP_001139807.1. NM_001146335.2. [Q9H2J7-3]
    NP_060527.2. NM_018057.6. [Q9H2J7-2]
    NP_877499.1. NM_182767.5. [Q9H2J7-1]
    UniGeneiHs.44424.

    Genome annotation databases

    EnsembliENST00000266682; ENSP00000266682; ENSG00000072041. [Q9H2J7-1]
    ENST00000450363; ENSP00000390706; ENSG00000072041. [Q9H2J7-2]
    ENST00000552192; ENSP00000450145; ENSG00000072041. [Q9H2J7-3]
    GeneIDi55117.
    KEGGihsa:55117.
    UCSCiuc001szv.4. human. [Q9H2J7-1]
    uc001szy.4. human. [Q9H2J7-2]

    Polymorphism databases

    DMDMi18202939.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF265577 mRNA. Translation: AAG41361.1 .
    AK022853 mRNA. Translation: BAB14274.1 .
    AK291207 mRNA. Translation: BAF83896.1 .
    AK294945 mRNA. Translation: BAH11933.1 .
    AC018922 Genomic DNA. No translation available.
    AC128657 Genomic DNA. No translation available.
    CH471054 Genomic DNA. Translation: EAW97389.1 .
    BC070040 mRNA. Translation: AAH70040.1 .
    CCDSi CCDS53816.1. [Q9H2J7-3 ]
    CCDS9026.1. [Q9H2J7-1 ]
    CCDS9027.1. [Q9H2J7-2 ]
    RefSeqi NP_001139807.1. NM_001146335.2. [Q9H2J7-3 ]
    NP_060527.2. NM_018057.6. [Q9H2J7-2 ]
    NP_877499.1. NM_182767.5. [Q9H2J7-1 ]
    UniGenei Hs.44424.

    3D structure databases

    ProteinModelPortali Q9H2J7.
    SMRi Q9H2J7. Positions 59-363, 435-637.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120426. 2 interactions.
    STRINGi 9606.ENSP00000266682.

    Protein family/group databases

    TCDBi 2.A.22.6.7. the neurotransmitter:sodium symporter (nss) family.

    PTM databases

    PhosphoSitei Q9H2J7.

    Polymorphism databases

    DMDMi 18202939.

    Proteomic databases

    MaxQBi Q9H2J7.
    PaxDbi Q9H2J7.
    PRIDEi Q9H2J7.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000266682 ; ENSP00000266682 ; ENSG00000072041 . [Q9H2J7-1 ]
    ENST00000450363 ; ENSP00000390706 ; ENSG00000072041 . [Q9H2J7-2 ]
    ENST00000552192 ; ENSP00000450145 ; ENSG00000072041 . [Q9H2J7-3 ]
    GeneIDi 55117.
    KEGGi hsa:55117.
    UCSCi uc001szv.4. human. [Q9H2J7-1 ]
    uc001szy.4. human. [Q9H2J7-2 ]

    Organism-specific databases

    CTDi 55117.
    GeneCardsi GC12M085253.
    HGNCi HGNC:13621. SLC6A15.
    HPAi HPA008609.
    MIMi 607971. gene.
    neXtProti NX_Q9H2J7.
    PharmGKBi PA37799.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0733.
    HOGENOMi HOG000116406.
    HOVERGENi HBG071421.
    InParanoidi Q9H2J7.
    KOi K05048.
    OMAi TPKLEMM.
    OrthoDBi EOG793B71.
    PhylomeDBi Q9H2J7.
    TreeFami TF352709.

    Enzyme and pathway databases

    Reactomei REACT_13796. Amino acid transport across the plasma membrane.
    REACT_20506. Na+/Cl- dependent neurotransmitter transporters.

    Miscellaneous databases

    ChiTaRSi SLC6A15. human.
    GeneWikii SLC6A15.
    GenomeRNAii 55117.
    NextBioi 58754.
    PROi Q9H2J7.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9H2J7.
    Bgeei Q9H2J7.
    CleanExi HS_SLC6A15.
    Genevestigatori Q9H2J7.

    Family and domain databases

    InterProi IPR000175. Na/ntran_symport.
    IPR002438. Na/ntran_symport_orphan.
    [Graphical view ]
    PANTHERi PTHR11616. PTHR11616. 1 hit.
    Pfami PF00209. SNF. 1 hit.
    [Graphical view ]
    PRINTSi PR00176. NANEUSMPORT.
    PR01206. ORPHTRNSPORT.
    PROSITEi PS00610. NA_NEUROTRAN_SYMP_1. 1 hit.
    PS00754. NA_NEUROTRAN_SYMP_2. 1 hit.
    PS50267. NA_NEUROTRAN_SYMP_3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and characterization of human NTT5 and v7-3: two orphan transporters of the Na(+)/Cl(-)-dependent neurotransmitter transporter gene family."
      Farmer M.K., Robbins M.J., Medhurst A.D., Campbell D.A., Ellington K., Duckworth M., Brown A.M., Middlemiss D.N., Price G.W., Pangalos M.N.
      Genomics 70:241-252(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Cerebellum.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), VARIANT VAL-400.
      Tissue: Brain.
    3. "The finished DNA sequence of human chromosome 12."
      Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
      , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
      Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Placenta.
    6. "Characterization of a branched-chain amino-acid transporter SBAT1 (SLC6A15) that is expressed in human brain."
      Takanaga H., Mackenzie B., Peng J.B., Hediger M.A.
      Biochem. Biophys. Res. Commun. 337:892-900(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY, FUNCTION, BIOPHYSICOCHEMICAL PROPERTIES.
    7. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-55 AND SER-687, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    10. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiS6A15_HUMAN
    AccessioniPrimary (citable) accession number: Q9H2J7
    Secondary accession number(s): A8K592
    , B7Z2P7, E7ESJ5, Q9H9F5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 26, 2001
    Last sequence update: March 1, 2001
    Last modified: October 1, 2014
    This is version 115 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3