SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9H2J7

- S6A15_HUMAN

UniProt

Q9H2J7 - S6A15_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Sodium-dependent neutral amino acid transporter B(0)AT2

Gene
SLC6A15, B0AT2, NTT73, SBAT1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Functions as a sodium-dependent neutral amino acid transporter. Exhibits preference for the branched-chain amino acids, particularly leucine, valine and isoleucine and methionine. Mediates the saturable, pH-sensitive and electrogenic cotransport of proline and sodium ions with a stoichiometry of 1:1. May have a role as transporter for neurotransmitter precursors into neurons. In contrast to other members of the neurotransmitter transporter family, does not appear to be chloride-dependent.1 Publication

Kineticsi

  1. KM=0.16 mM for L-leucine (at pH 7.5, 100 mM NaCL, -70 mV)1 Publication
  2. KM=0.16 mM for L-valine (at pH 7.5, 100 mM NaCL, -70 mV))
  3. KM=0.08 mM for L-isoleucine (at pH 7.5, 100 mM NaCL, -70 mV)
  4. KM=0.11 mM for L-methionine (at pH 7.5, 100 mM NaCL, -70 mV)
  5. KM=0.38 mM for L-proline (at pH 7.5, 100 mM NaCL, -70 mV)

pH dependencei

Optimum pH is 7.5-8.5. Strongly inhibited at acidic PH.

GO - Molecular functioni

  1. neurotransmitter:sodium symporter activity Source: InterPro
  2. neurotransmitter transporter activity Source: UniProtKB
  3. proline:sodium symporter activity Source: Ensembl

GO - Biological processi

  1. amino acid transport Source: Reactome
  2. ion transport Source: Reactome
  3. leucine transport Source: UniProtKB
  4. neurotransmitter transport Source: UniProtKB
  5. neutral amino acid transport Source: UniProtKB
  6. proline transport Source: UniProtKB
  7. transmembrane transport Source: Reactome
Complete GO annotation...

Keywords - Biological processi

Amino-acid transport, Ion transport, Neurotransmitter transport, Sodium transport, Symport, Transport

Keywords - Ligandi

Sodium

Enzyme and pathway databases

ReactomeiREACT_13796. Amino acid transport across the plasma membrane.
REACT_20506. Na+/Cl- dependent neurotransmitter transporters.

Protein family/group databases

TCDBi2.A.22.6.7. the neurotransmitter:sodium symporter (nss) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium-dependent neutral amino acid transporter B(0)AT2
Alternative name(s):
Sodium- and chloride-dependent neurotransmitter transporter NTT73
Sodium-coupled branched-chain amino-acid transporter 1
Solute carrier family 6 member 15
Transporter v7-3
Gene namesi
Name:SLC6A15
Synonyms:B0AT2, NTT73, SBAT1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:13621. SLC6A15.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 6969Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei70 – 9021Helical; Name=1; Reviewed predictionAdd
BLAST
Transmembranei98 – 11720Helical; Name=2; Reviewed predictionAdd
BLAST
Transmembranei142 – 16221Helical; Name=3; Reviewed predictionAdd
BLAST
Topological domaini163 – 22563Extracellular Reviewed predictionAdd
BLAST
Transmembranei226 – 24419Helical; Name=4; Reviewed predictionAdd
BLAST
Transmembranei253 – 27018Helical; Name=5; Reviewed predictionAdd
BLAST
Transmembranei306 – 32318Helical; Name=6; Reviewed predictionAdd
BLAST
Transmembranei335 – 35622Helical; Name=7; Reviewed predictionAdd
BLAST
Topological domaini357 – 45296Extracellular Reviewed predictionAdd
BLAST
Transmembranei453 – 47220Helical; Name=8; Reviewed predictionAdd
BLAST
Transmembranei496 – 51419Helical; Name=9; Reviewed predictionAdd
BLAST
Transmembranei530 – 55021Helical; Name=10; Reviewed predictionAdd
BLAST
Transmembranei571 – 59222Helical; Name=11; Reviewed predictionAdd
BLAST
Transmembranei620 – 64223Helical; Name=12; Reviewed predictionAdd
BLAST
Topological domaini643 – 73088Cytoplasmic Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB
  2. integral component of plasma membrane Source: InterPro
  3. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA37799.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 730730Sodium-dependent neutral amino acid transporter B(0)AT2PRO_0000214798Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei55 – 551Phosphoserine1 Publication
Glycosylationi187 – 1871N-linked (GlcNAc...) Reviewed prediction
Glycosylationi213 – 2131N-linked (GlcNAc...) Reviewed prediction
Glycosylationi383 – 3831N-linked (GlcNAc...) Reviewed prediction
Glycosylationi394 – 3941N-linked (GlcNAc...) Reviewed prediction
Modified residuei687 – 6871Phosphoserine1 Publication

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ9H2J7.
PaxDbiQ9H2J7.
PRIDEiQ9H2J7.

PTM databases

PhosphoSiteiQ9H2J7.

Expressioni

Tissue specificityi

Almost exclusively expressed in the brain.1 Publication

Gene expression databases

ArrayExpressiQ9H2J7.
BgeeiQ9H2J7.
CleanExiHS_SLC6A15.
GenevestigatoriQ9H2J7.

Organism-specific databases

HPAiHPA008609.

Interactioni

Protein-protein interaction databases

BioGridi120426. 2 interactions.
STRINGi9606.ENSP00000266682.

Structurei

3D structure databases

ProteinModelPortaliQ9H2J7.
SMRiQ9H2J7. Positions 59-363, 435-637.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0733.
HOGENOMiHOG000116406.
HOVERGENiHBG071421.
InParanoidiQ9H2J7.
KOiK05048.
OMAiTPKLEMM.
OrthoDBiEOG793B71.
PhylomeDBiQ9H2J7.
TreeFamiTF352709.

Family and domain databases

InterProiIPR000175. Na/ntran_symport.
IPR002438. Na/ntran_symport_orphan.
[Graphical view]
PANTHERiPTHR11616. PTHR11616. 1 hit.
PfamiPF00209. SNF. 1 hit.
[Graphical view]
PRINTSiPR00176. NANEUSMPORT.
PR01206. ORPHTRNSPORT.
PROSITEiPS00610. NA_NEUROTRAN_SYMP_1. 1 hit.
PS00754. NA_NEUROTRAN_SYMP_2. 1 hit.
PS50267. NA_NEUROTRAN_SYMP_3. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9H2J7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MPKNSKVVKR ELDDDVTESV KDLLSNEDAA DDAFKTSELI VDGQEEKDTD    50
VEEGSEVEDE RPAWNSKLQY ILAQVGFSVG LGNVWRFPYL CQKNGGGAYL 100
LPYLILLMVI GIPLFFLELS VGQRIRRGSI GVWNYISPKL GGIGFASCVV 150
CYFVALYYNV IIGWSLFYFS QSFQQPLPWD QCPLVKNASH TFVEPECEQS 200
SATTYYWYRE ALNISSSISE SGGLNWKMTI CLLAAWVMVC LAMIKGIQSS 250
GKIIYFSSLF PYVVLICFLI RAFLLNGSID GIRHMFTPKL EIMLEPKVWR 300
EAATQVFFAL GLGFGGVIAF SSYNKRDNNC HFDAVLVSFI NFFTSVLATL 350
VVFAVLGFKA NVINEKCITQ NSETIMKFLK MGNISQDIIP HHINLSTVTA 400
EDYHLVYDII QKVKEEEFPA LHLNSCKIEE ELNKAVQGTG LAFIAFTEAM 450
THFPASPFWS VMFFLMLVNL GLGSMFGTIE GIVTPIVDTF KVRKEILTVI 500
CCLLAFCIGL IFVQRSGNYF VTMFDDYSAT LPLLIVVILE NIAVCFVYGI 550
DKFMEDLKDM LGFAPSRYYY YMWKYISPLM LLSLLIASVV NMGLSPPGYN 600
AWIEDKASEE FLSYPTWGLV VCVSLVVFAI LPVPVVFIVR RFNLIDDSSG 650
NLASVTYKRG RVLKEPVNLE GDDTSLIHGK IPSEMPSPNF GKNIYRKQSG 700
SPTLDTAPNG RYGIGYLMAD IMPDMPESDL 730
Length:730
Mass (Da):81,836
Last modified:March 1, 2001 - v1
Checksum:i45963118E06CFFE6
GO
Isoform 2 (identifier: Q9H2J7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     253-289: IIYFSSLFPYVVLICFLIRAFLLNGSIDGIRHMFTPK → VSMLEPFLILLITISGFIPLSNSVTDFCGQITHNTSF
     290-730: Missing.

Note: No experimental confirmation available.

Show »
Length:289
Mass (Da):32,264
Checksum:iAB0768CD8F74BF47
GO
Isoform 3 (identifier: Q9H2J7-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-107: Missing.

Note: No experimental confirmation available.

Show »
Length:623
Mass (Da):69,886
Checksum:iDB10A517144B0643
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti400 – 4001A → V.1 Publication
Corresponds to variant rs12424429 [ dbSNP | Ensembl ].
VAR_052065
Natural varianti603 – 6031I → M.
Corresponds to variant rs3782369 [ dbSNP | Ensembl ].
VAR_052066

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 107107Missing in isoform 3. VSP_045192Add
BLAST
Alternative sequencei253 – 28937IIYFS…MFTPK → VSMLEPFLILLITISGFIPL SNSVTDFCGQITHNTSF in isoform 2. VSP_043030Add
BLAST
Alternative sequencei290 – 730441Missing in isoform 2. VSP_043031Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF265577 mRNA. Translation: AAG41361.1.
AK022853 mRNA. Translation: BAB14274.1.
AK291207 mRNA. Translation: BAF83896.1.
AK294945 mRNA. Translation: BAH11933.1.
AC018922 Genomic DNA. No translation available.
AC128657 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW97389.1.
BC070040 mRNA. Translation: AAH70040.1.
CCDSiCCDS53816.1. [Q9H2J7-3]
CCDS9026.1. [Q9H2J7-1]
CCDS9027.1. [Q9H2J7-2]
RefSeqiNP_001139807.1. NM_001146335.2. [Q9H2J7-3]
NP_060527.2. NM_018057.6. [Q9H2J7-2]
NP_877499.1. NM_182767.5. [Q9H2J7-1]
UniGeneiHs.44424.

Genome annotation databases

EnsembliENST00000266682; ENSP00000266682; ENSG00000072041. [Q9H2J7-1]
ENST00000450363; ENSP00000390706; ENSG00000072041. [Q9H2J7-2]
ENST00000552192; ENSP00000450145; ENSG00000072041. [Q9H2J7-3]
GeneIDi55117.
KEGGihsa:55117.
UCSCiuc001szv.4. human. [Q9H2J7-1]
uc001szy.4. human. [Q9H2J7-2]

Polymorphism databases

DMDMi18202939.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF265577 mRNA. Translation: AAG41361.1 .
AK022853 mRNA. Translation: BAB14274.1 .
AK291207 mRNA. Translation: BAF83896.1 .
AK294945 mRNA. Translation: BAH11933.1 .
AC018922 Genomic DNA. No translation available.
AC128657 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW97389.1 .
BC070040 mRNA. Translation: AAH70040.1 .
CCDSi CCDS53816.1. [Q9H2J7-3 ]
CCDS9026.1. [Q9H2J7-1 ]
CCDS9027.1. [Q9H2J7-2 ]
RefSeqi NP_001139807.1. NM_001146335.2. [Q9H2J7-3 ]
NP_060527.2. NM_018057.6. [Q9H2J7-2 ]
NP_877499.1. NM_182767.5. [Q9H2J7-1 ]
UniGenei Hs.44424.

3D structure databases

ProteinModelPortali Q9H2J7.
SMRi Q9H2J7. Positions 59-363, 435-637.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120426. 2 interactions.
STRINGi 9606.ENSP00000266682.

Protein family/group databases

TCDBi 2.A.22.6.7. the neurotransmitter:sodium symporter (nss) family.

PTM databases

PhosphoSitei Q9H2J7.

Polymorphism databases

DMDMi 18202939.

Proteomic databases

MaxQBi Q9H2J7.
PaxDbi Q9H2J7.
PRIDEi Q9H2J7.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000266682 ; ENSP00000266682 ; ENSG00000072041 . [Q9H2J7-1 ]
ENST00000450363 ; ENSP00000390706 ; ENSG00000072041 . [Q9H2J7-2 ]
ENST00000552192 ; ENSP00000450145 ; ENSG00000072041 . [Q9H2J7-3 ]
GeneIDi 55117.
KEGGi hsa:55117.
UCSCi uc001szv.4. human. [Q9H2J7-1 ]
uc001szy.4. human. [Q9H2J7-2 ]

Organism-specific databases

CTDi 55117.
GeneCardsi GC12M085253.
HGNCi HGNC:13621. SLC6A15.
HPAi HPA008609.
MIMi 607971. gene.
neXtProti NX_Q9H2J7.
PharmGKBi PA37799.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0733.
HOGENOMi HOG000116406.
HOVERGENi HBG071421.
InParanoidi Q9H2J7.
KOi K05048.
OMAi TPKLEMM.
OrthoDBi EOG793B71.
PhylomeDBi Q9H2J7.
TreeFami TF352709.

Enzyme and pathway databases

Reactomei REACT_13796. Amino acid transport across the plasma membrane.
REACT_20506. Na+/Cl- dependent neurotransmitter transporters.

Miscellaneous databases

ChiTaRSi SLC6A15. human.
GeneWikii SLC6A15.
GenomeRNAii 55117.
NextBioi 58754.
PROi Q9H2J7.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9H2J7.
Bgeei Q9H2J7.
CleanExi HS_SLC6A15.
Genevestigatori Q9H2J7.

Family and domain databases

InterProi IPR000175. Na/ntran_symport.
IPR002438. Na/ntran_symport_orphan.
[Graphical view ]
PANTHERi PTHR11616. PTHR11616. 1 hit.
Pfami PF00209. SNF. 1 hit.
[Graphical view ]
PRINTSi PR00176. NANEUSMPORT.
PR01206. ORPHTRNSPORT.
PROSITEi PS00610. NA_NEUROTRAN_SYMP_1. 1 hit.
PS00754. NA_NEUROTRAN_SYMP_2. 1 hit.
PS50267. NA_NEUROTRAN_SYMP_3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of human NTT5 and v7-3: two orphan transporters of the Na(+)/Cl(-)-dependent neurotransmitter transporter gene family."
    Farmer M.K., Robbins M.J., Medhurst A.D., Campbell D.A., Ellington K., Duckworth M., Brown A.M., Middlemiss D.N., Price G.W., Pangalos M.N.
    Genomics 70:241-252(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Cerebellum.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), VARIANT VAL-400.
    Tissue: Brain.
  3. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Placenta.
  6. "Characterization of a branched-chain amino-acid transporter SBAT1 (SLC6A15) that is expressed in human brain."
    Takanaga H., Mackenzie B., Peng J.B., Hediger M.A.
    Biochem. Biophys. Res. Commun. 337:892-900(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, FUNCTION, BIOPHYSICOCHEMICAL PROPERTIES.
  7. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-55 AND SER-687, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiS6A15_HUMAN
AccessioniPrimary (citable) accession number: Q9H2J7
Secondary accession number(s): A8K592
, B7Z2P7, E7ESJ5, Q9H9F5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: March 1, 2001
Last modified: September 3, 2014
This is version 114 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi