Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9H2J7 (S6A15_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 113. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Sodium-dependent neutral amino acid transporter B(0)AT2
Alternative name(s):
Sodium- and chloride-dependent neurotransmitter transporter NTT73
Sodium-coupled branched-chain amino-acid transporter 1
Solute carrier family 6 member 15
Transporter v7-3
Gene names
Name:SLC6A15
Synonyms:B0AT2, NTT73, SBAT1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length730 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Functions as a sodium-dependent neutral amino acid transporter. Exhibits preference for the branched-chain amino acids, particularly leucine, valine and isoleucine and methionine. Mediates the saturable, pH-sensitive and electrogenic cotransport of proline and sodium ions with a stoichiometry of 1:1. May have a role as transporter for neurotransmitter precursors into neurons. In contrast to other members of the neurotransmitter transporter family, does not appear to be chloride-dependent. Ref.6

Subcellular location

Membrane; Multi-pass membrane protein Probable.

Tissue specificity

Almost exclusively expressed in the brain. Ref.6

Sequence similarities

Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A15 subfamily. [View classification]

Biophysicochemical properties

Kinetic parameters:

KM=0.16 mM for L-leucine (at pH 7.5, 100 mM NaCL, -70 mV) Ref.6

KM=0.16 mM for L-valine (at pH 7.5, 100 mM NaCL, -70 mV))

KM=0.08 mM for L-isoleucine (at pH 7.5, 100 mM NaCL, -70 mV)

KM=0.11 mM for L-methionine (at pH 7.5, 100 mM NaCL, -70 mV)

KM=0.38 mM for L-proline (at pH 7.5, 100 mM NaCL, -70 mV)

pH dependence:

Optimum pH is 7.5-8.5. Strongly inhibited at acidic PH.

Ontologies

Keywords
   Biological processAmino-acid transport
Ion transport
Neurotransmitter transport
Sodium transport
Symport
Transport
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainTransmembrane
Transmembrane helix
   LigandSodium
   PTMGlycoprotein
Phosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processamino acid transport

Traceable author statement. Source: Reactome

ion transport

Traceable author statement. Source: Reactome

leucine transport

Inferred from sequence or structural similarity. Source: UniProtKB

neurotransmitter transport

Non-traceable author statement Ref.1. Source: UniProtKB

neutral amino acid transport

Inferred from direct assay Ref.6. Source: UniProtKB

proline transport

Inferred from sequence or structural similarity. Source: UniProtKB

transmembrane transport

Traceable author statement. Source: Reactome

   Cellular_componentintegral component of membrane

Non-traceable author statement Ref.1. Source: UniProtKB

integral component of plasma membrane

Inferred from electronic annotation. Source: InterPro

plasma membrane

Traceable author statement. Source: Reactome

   Molecular_functionneurotransmitter transporter activity

Non-traceable author statement Ref.1. Source: UniProtKB

neurotransmitter:sodium symporter activity

Inferred from electronic annotation. Source: InterPro

proline:sodium symporter activity

Inferred from electronic annotation. Source: Ensembl

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9H2J7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9H2J7-2)

The sequence of this isoform differs from the canonical sequence as follows:
     253-289: IIYFSSLFPYVVLICFLIRAFLLNGSIDGIRHMFTPK → VSMLEPFLILLITISGFIPLSNSVTDFCGQITHNTSF
     290-730: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q9H2J7-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-107: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 730730Sodium-dependent neutral amino acid transporter B(0)AT2
PRO_0000214798

Regions

Topological domain1 – 6969Cytoplasmic Potential
Transmembrane70 – 9021Helical; Name=1; Potential
Transmembrane98 – 11720Helical; Name=2; Potential
Transmembrane142 – 16221Helical; Name=3; Potential
Topological domain163 – 22563Extracellular Potential
Transmembrane226 – 24419Helical; Name=4; Potential
Transmembrane253 – 27018Helical; Name=5; Potential
Transmembrane306 – 32318Helical; Name=6; Potential
Transmembrane335 – 35622Helical; Name=7; Potential
Topological domain357 – 45296Extracellular Potential
Transmembrane453 – 47220Helical; Name=8; Potential
Transmembrane496 – 51419Helical; Name=9; Potential
Transmembrane530 – 55021Helical; Name=10; Potential
Transmembrane571 – 59222Helical; Name=11; Potential
Transmembrane620 – 64223Helical; Name=12; Potential
Topological domain643 – 73088Cytoplasmic Potential

Amino acid modifications

Modified residue551Phosphoserine Ref.7
Modified residue6871Phosphoserine Ref.7
Glycosylation1871N-linked (GlcNAc...) Potential
Glycosylation2131N-linked (GlcNAc...) Potential
Glycosylation3831N-linked (GlcNAc...) Potential
Glycosylation3941N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1 – 107107Missing in isoform 3.
VSP_045192
Alternative sequence253 – 28937IIYFS…MFTPK → VSMLEPFLILLITISGFIPL SNSVTDFCGQITHNTSF in isoform 2.
VSP_043030
Alternative sequence290 – 730441Missing in isoform 2.
VSP_043031
Natural variant4001A → V. Ref.2
Corresponds to variant rs12424429 [ dbSNP | Ensembl ].
VAR_052065
Natural variant6031I → M.
Corresponds to variant rs3782369 [ dbSNP | Ensembl ].
VAR_052066

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 1, 2001. Version 1.
Checksum: 45963118E06CFFE6

FASTA73081,836
        10         20         30         40         50         60 
MPKNSKVVKR ELDDDVTESV KDLLSNEDAA DDAFKTSELI VDGQEEKDTD VEEGSEVEDE 

        70         80         90        100        110        120 
RPAWNSKLQY ILAQVGFSVG LGNVWRFPYL CQKNGGGAYL LPYLILLMVI GIPLFFLELS 

       130        140        150        160        170        180 
VGQRIRRGSI GVWNYISPKL GGIGFASCVV CYFVALYYNV IIGWSLFYFS QSFQQPLPWD 

       190        200        210        220        230        240 
QCPLVKNASH TFVEPECEQS SATTYYWYRE ALNISSSISE SGGLNWKMTI CLLAAWVMVC 

       250        260        270        280        290        300 
LAMIKGIQSS GKIIYFSSLF PYVVLICFLI RAFLLNGSID GIRHMFTPKL EIMLEPKVWR 

       310        320        330        340        350        360 
EAATQVFFAL GLGFGGVIAF SSYNKRDNNC HFDAVLVSFI NFFTSVLATL VVFAVLGFKA 

       370        380        390        400        410        420 
NVINEKCITQ NSETIMKFLK MGNISQDIIP HHINLSTVTA EDYHLVYDII QKVKEEEFPA 

       430        440        450        460        470        480 
LHLNSCKIEE ELNKAVQGTG LAFIAFTEAM THFPASPFWS VMFFLMLVNL GLGSMFGTIE 

       490        500        510        520        530        540 
GIVTPIVDTF KVRKEILTVI CCLLAFCIGL IFVQRSGNYF VTMFDDYSAT LPLLIVVILE 

       550        560        570        580        590        600 
NIAVCFVYGI DKFMEDLKDM LGFAPSRYYY YMWKYISPLM LLSLLIASVV NMGLSPPGYN 

       610        620        630        640        650        660 
AWIEDKASEE FLSYPTWGLV VCVSLVVFAI LPVPVVFIVR RFNLIDDSSG NLASVTYKRG 

       670        680        690        700        710        720 
RVLKEPVNLE GDDTSLIHGK IPSEMPSPNF GKNIYRKQSG SPTLDTAPNG RYGIGYLMAD 

       730 
IMPDMPESDL 

« Hide

Isoform 2 [UniParc].

Checksum: AB0768CD8F74BF47
Show »

FASTA28932,264
Isoform 3 [UniParc].

Checksum: DB10A517144B0643
Show »

FASTA62369,886

References

« Hide 'large scale' references
[1]"Cloning and characterization of human NTT5 and v7-3: two orphan transporters of the Na(+)/Cl(-)-dependent neurotransmitter transporter gene family."
Farmer M.K., Robbins M.J., Medhurst A.D., Campbell D.A., Ellington K., Duckworth M., Brown A.M., Middlemiss D.N., Price G.W., Pangalos M.N.
Genomics 70:241-252(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Cerebellum.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), VARIANT VAL-400.
Tissue: Brain.
[3]"The finished DNA sequence of human chromosome 12."
Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. expand/collapse author list , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Placenta.
[6]"Characterization of a branched-chain amino-acid transporter SBAT1 (SLC6A15) that is expressed in human brain."
Takanaga H., Mackenzie B., Peng J.B., Hediger M.A.
Biochem. Biophys. Res. Commun. 337:892-900(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY, FUNCTION, BIOPHYSICOCHEMICAL PROPERTIES.
[7]"Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-55 AND SER-687, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[8]"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[9]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[10]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[11]"N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB."
Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.
Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF265577 mRNA. Translation: AAG41361.1.
AK022853 mRNA. Translation: BAB14274.1.
AK291207 mRNA. Translation: BAF83896.1.
AK294945 mRNA. Translation: BAH11933.1.
AC018922 Genomic DNA. No translation available.
AC128657 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW97389.1.
BC070040 mRNA. Translation: AAH70040.1.
CCDSCCDS53816.1. [Q9H2J7-3]
CCDS9026.1. [Q9H2J7-1]
CCDS9027.1. [Q9H2J7-2]
RefSeqNP_001139807.1. NM_001146335.2. [Q9H2J7-3]
NP_060527.2. NM_018057.6. [Q9H2J7-2]
NP_877499.1. NM_182767.5. [Q9H2J7-1]
UniGeneHs.44424.

3D structure databases

ProteinModelPortalQ9H2J7.
SMRQ9H2J7. Positions 59-363, 435-637.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120426. 2 interactions.
STRING9606.ENSP00000266682.

Protein family/group databases

TCDB2.A.22.6.7. the neurotransmitter:sodium symporter (nss) family.

PTM databases

PhosphoSiteQ9H2J7.

Polymorphism databases

DMDM18202939.

Proteomic databases

MaxQBQ9H2J7.
PaxDbQ9H2J7.
PRIDEQ9H2J7.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000266682; ENSP00000266682; ENSG00000072041. [Q9H2J7-1]
ENST00000450363; ENSP00000390706; ENSG00000072041. [Q9H2J7-2]
ENST00000552192; ENSP00000450145; ENSG00000072041. [Q9H2J7-3]
GeneID55117.
KEGGhsa:55117.
UCSCuc001szv.4. human. [Q9H2J7-1]
uc001szy.4. human. [Q9H2J7-2]

Organism-specific databases

CTD55117.
GeneCardsGC12M085253.
HGNCHGNC:13621. SLC6A15.
HPAHPA008609.
MIM607971. gene.
neXtProtNX_Q9H2J7.
PharmGKBPA37799.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0733.
HOGENOMHOG000116406.
HOVERGENHBG071421.
InParanoidQ9H2J7.
KOK05048.
OMATPKLEMM.
OrthoDBEOG793B71.
PhylomeDBQ9H2J7.
TreeFamTF352709.

Enzyme and pathway databases

ReactomeREACT_15518. Transmembrane transport of small molecules.
REACT_19419. Amino acid and oligopeptide SLC transporters.
REACT_20679. Amine compound SLC transporters.

Gene expression databases

ArrayExpressQ9H2J7.
BgeeQ9H2J7.
CleanExHS_SLC6A15.
GenevestigatorQ9H2J7.

Family and domain databases

InterProIPR000175. Na/ntran_symport.
IPR002438. Na/ntran_symport_orphan.
[Graphical view]
PANTHERPTHR11616. PTHR11616. 1 hit.
PfamPF00209. SNF. 1 hit.
[Graphical view]
PRINTSPR00176. NANEUSMPORT.
PR01206. ORPHTRNSPORT.
PROSITEPS00610. NA_NEUROTRAN_SYMP_1. 1 hit.
PS00754. NA_NEUROTRAN_SYMP_2. 1 hit.
PS50267. NA_NEUROTRAN_SYMP_3. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSSLC6A15. human.
GeneWikiSLC6A15.
GenomeRNAi55117.
NextBio58754.
PROQ9H2J7.
SOURCESearch...

Entry information

Entry nameS6A15_HUMAN
AccessionPrimary (citable) accession number: Q9H2J7
Secondary accession number(s): A8K592 expand/collapse secondary AC list , B7Z2P7, E7ESJ5, Q9H9F5
Entry history
Integrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: March 1, 2001
Last modified: July 9, 2014
This is version 113 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM