Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium-dependent neutral amino acid transporter B(0)AT2

Gene

SLC6A15

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Functions as a sodium-dependent neutral amino acid transporter. Exhibits preference for the branched-chain amino acids, particularly leucine, valine and isoleucine and methionine. Mediates the saturable, pH-sensitive and electrogenic cotransport of proline and sodium ions with a stoichiometry of 1:1. May have a role as transporter for neurotransmitter precursors into neurons. In contrast to other members of the neurotransmitter transporter family, does not appear to be chloride-dependent.1 Publication

Kineticsi

  1. KM=0.16 mM for L-leucine (at pH 7.5, 100 mM NaCL, -70 mV)1 Publication
  2. KM=0.16 mM for L-valine (at pH 7.5, 100 mM NaCL, -70 mV))1 Publication
  3. KM=0.08 mM for L-isoleucine (at pH 7.5, 100 mM NaCL, -70 mV)1 Publication
  4. KM=0.11 mM for L-methionine (at pH 7.5, 100 mM NaCL, -70 mV)1 Publication
  5. KM=0.38 mM for L-proline (at pH 7.5, 100 mM NaCL, -70 mV)1 Publication

    pH dependencei

    Optimum pH is 7.5-8.5. Strongly inhibited at acidic PH.1 Publication

    GO - Molecular functioni

    GO - Biological processi

    • amino acid transport Source: Reactome
    • leucine transport Source: UniProtKB
    • neurotransmitter transport Source: UniProtKB
    • neutral amino acid transport Source: UniProtKB
    • proline transport Source: UniProtKB
    Complete GO annotation...

    Keywords - Biological processi

    Amino-acid transport, Ion transport, Neurotransmitter transport, Sodium transport, Symport, Transport

    Keywords - Ligandi

    Sodium

    Enzyme and pathway databases

    BioCyciZFISH:ENSG00000072041-MONOMER.
    ReactomeiR-HSA-352230. Amino acid transport across the plasma membrane.
    R-HSA-442660. Na+/Cl- dependent neurotransmitter transporters.

    Protein family/group databases

    TCDBi2.A.22.6.7. the neurotransmitter:sodium symporter (nss) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sodium-dependent neutral amino acid transporter B(0)AT2
    Alternative name(s):
    Sodium- and chloride-dependent neurotransmitter transporter NTT73
    Sodium-coupled branched-chain amino-acid transporter 1
    Solute carrier family 6 member 15
    Transporter v7-3
    Gene namesi
    Name:SLC6A15
    Synonyms:B0AT2, NTT73, SBAT1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    Proteomesi
    • UP000005640 Componenti: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:13621. SLC6A15.

    Subcellular locationi

    Topology

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Topological domaini1 – 69CytoplasmicSequence analysisAdd BLAST69
    Transmembranei70 – 90Helical; Name=1Sequence analysisAdd BLAST21
    Transmembranei98 – 117Helical; Name=2Sequence analysisAdd BLAST20
    Transmembranei142 – 162Helical; Name=3Sequence analysisAdd BLAST21
    Topological domaini163 – 225ExtracellularSequence analysisAdd BLAST63
    Transmembranei226 – 244Helical; Name=4Sequence analysisAdd BLAST19
    Transmembranei253 – 270Helical; Name=5Sequence analysisAdd BLAST18
    Transmembranei306 – 323Helical; Name=6Sequence analysisAdd BLAST18
    Transmembranei335 – 356Helical; Name=7Sequence analysisAdd BLAST22
    Topological domaini357 – 452ExtracellularSequence analysisAdd BLAST96
    Transmembranei453 – 472Helical; Name=8Sequence analysisAdd BLAST20
    Transmembranei496 – 514Helical; Name=9Sequence analysisAdd BLAST19
    Transmembranei530 – 550Helical; Name=10Sequence analysisAdd BLAST21
    Transmembranei571 – 592Helical; Name=11Sequence analysisAdd BLAST22
    Transmembranei620 – 642Helical; Name=12Sequence analysisAdd BLAST23
    Topological domaini643 – 730CytoplasmicSequence analysisAdd BLAST88

    GO - Cellular componenti

    • integral component of membrane Source: UniProtKB
    • integral component of plasma membrane Source: GO_Central
    • plasma membrane Source: Reactome
    Complete GO annotation...

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    DisGeNETi55117.
    OpenTargetsiENSG00000072041.
    PharmGKBiPA37799.

    Chemistry databases

    ChEMBLiCHEMBL3351189.
    GuidetoPHARMACOLOGYi940.

    Polymorphism and mutation databases

    BioMutaiSLC6A15.
    DMDMi18202939.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    ChainiPRO_00002147981 – 730Sodium-dependent neutral amino acid transporter B(0)AT2Add BLAST730

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Modified residuei19PhosphoserineBy similarity1
    Modified residuei25PhosphoserineCombined sources1
    Modified residuei55PhosphoserineCombined sources1
    Glycosylationi187N-linked (GlcNAc...)Sequence analysis1
    Glycosylationi213N-linked (GlcNAc...)Sequence analysis1
    Glycosylationi383N-linked (GlcNAc...)Sequence analysis1
    Glycosylationi394N-linked (GlcNAc...)Sequence analysis1
    Modified residuei687PhosphoserineCombined sources1
    Modified residuei699PhosphoserineCombined sources1
    Modified residuei701PhosphoserineCombined sources1

    Keywords - PTMi

    Glycoprotein, Phosphoprotein

    Proteomic databases

    EPDiQ9H2J7.
    MaxQBiQ9H2J7.
    PaxDbiQ9H2J7.
    PeptideAtlasiQ9H2J7.
    PRIDEiQ9H2J7.

    PTM databases

    iPTMnetiQ9H2J7.
    PhosphoSitePlusiQ9H2J7.

    Expressioni

    Tissue specificityi

    Almost exclusively expressed in the brain.1 Publication

    Gene expression databases

    BgeeiENSG00000072041.
    CleanExiHS_SLC6A15.
    ExpressionAtlasiQ9H2J7. baseline and differential.
    GenevisibleiQ9H2J7. HS.

    Organism-specific databases

    HPAiHPA008609.

    Interactioni

    Protein-protein interaction databases

    BioGridi120426. 27 interactors.
    IntActiQ9H2J7. 2 interactors.
    STRINGi9606.ENSP00000266682.

    Chemistry databases

    BindingDBiQ9H2J7.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9H2J7.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiKOG3659. Eukaryota.
    COG0733. LUCA.
    GeneTreeiENSGT00760000119044.
    HOGENOMiHOG000116406.
    HOVERGENiHBG071421.
    InParanoidiQ9H2J7.
    KOiK05048.
    OMAiAWVVVCL.
    OrthoDBiEOG091G08PX.
    PhylomeDBiQ9H2J7.
    TreeFamiTF352709.

    Family and domain databases

    InterProiIPR000175. Na/ntran_symport.
    IPR002438. Na/ntran_symport_orphan.
    [Graphical view]
    PANTHERiPTHR11616. PTHR11616. 2 hits.
    PfamiPF00209. SNF. 1 hit.
    [Graphical view]
    PRINTSiPR00176. NANEUSMPORT.
    PR01206. ORPHTRNSPORT.
    PROSITEiPS00610. NA_NEUROTRAN_SYMP_1. 1 hit.
    PS00754. NA_NEUROTRAN_SYMP_2. 1 hit.
    PS50267. NA_NEUROTRAN_SYMP_3. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

    Isoform 1 (identifier: Q9H2J7-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

            10         20         30         40         50
    MPKNSKVVKR ELDDDVTESV KDLLSNEDAA DDAFKTSELI VDGQEEKDTD
    60 70 80 90 100
    VEEGSEVEDE RPAWNSKLQY ILAQVGFSVG LGNVWRFPYL CQKNGGGAYL
    110 120 130 140 150
    LPYLILLMVI GIPLFFLELS VGQRIRRGSI GVWNYISPKL GGIGFASCVV
    160 170 180 190 200
    CYFVALYYNV IIGWSLFYFS QSFQQPLPWD QCPLVKNASH TFVEPECEQS
    210 220 230 240 250
    SATTYYWYRE ALNISSSISE SGGLNWKMTI CLLAAWVMVC LAMIKGIQSS
    260 270 280 290 300
    GKIIYFSSLF PYVVLICFLI RAFLLNGSID GIRHMFTPKL EIMLEPKVWR
    310 320 330 340 350
    EAATQVFFAL GLGFGGVIAF SSYNKRDNNC HFDAVLVSFI NFFTSVLATL
    360 370 380 390 400
    VVFAVLGFKA NVINEKCITQ NSETIMKFLK MGNISQDIIP HHINLSTVTA
    410 420 430 440 450
    EDYHLVYDII QKVKEEEFPA LHLNSCKIEE ELNKAVQGTG LAFIAFTEAM
    460 470 480 490 500
    THFPASPFWS VMFFLMLVNL GLGSMFGTIE GIVTPIVDTF KVRKEILTVI
    510 520 530 540 550
    CCLLAFCIGL IFVQRSGNYF VTMFDDYSAT LPLLIVVILE NIAVCFVYGI
    560 570 580 590 600
    DKFMEDLKDM LGFAPSRYYY YMWKYISPLM LLSLLIASVV NMGLSPPGYN
    610 620 630 640 650
    AWIEDKASEE FLSYPTWGLV VCVSLVVFAI LPVPVVFIVR RFNLIDDSSG
    660 670 680 690 700
    NLASVTYKRG RVLKEPVNLE GDDTSLIHGK IPSEMPSPNF GKNIYRKQSG
    710 720 730
    SPTLDTAPNG RYGIGYLMAD IMPDMPESDL
    Length:730
    Mass (Da):81,836
    Last modified:March 1, 2001 - v1
    Checksum:i45963118E06CFFE6
    GO
    Isoform 2 (identifier: Q9H2J7-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         253-289: IIYFSSLFPYVVLICFLIRAFLLNGSIDGIRHMFTPK → VSMLEPFLILLITISGFIPLSNSVTDFCGQITHNTSF
         290-730: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:289
    Mass (Da):32,264
    Checksum:iAB0768CD8F74BF47
    GO
    Isoform 3 (identifier: Q9H2J7-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-107: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:623
    Mass (Da):69,886
    Checksum:iDB10A517144B0643
    GO

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Natural variantiVAR_052065400A → V.1 PublicationCorresponds to variant rs12424429dbSNPEnsembl.1
    Natural variantiVAR_052066603I → M.Corresponds to variant rs3782369dbSNPEnsembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Alternative sequenceiVSP_0451921 – 107Missing in isoform 3. 1 PublicationAdd BLAST107
    Alternative sequenceiVSP_043030253 – 289IIYFS…MFTPK → VSMLEPFLILLITISGFIPL SNSVTDFCGQITHNTSF in isoform 2. 1 PublicationAdd BLAST37
    Alternative sequenceiVSP_043031290 – 730Missing in isoform 2. 1 PublicationAdd BLAST441

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AF265577 mRNA. Translation: AAG41361.1.
    AK022853 mRNA. Translation: BAB14274.1.
    AK291207 mRNA. Translation: BAF83896.1.
    AK294945 mRNA. Translation: BAH11933.1.
    AC018922 Genomic DNA. No translation available.
    AC128657 Genomic DNA. No translation available.
    CH471054 Genomic DNA. Translation: EAW97389.1.
    BC070040 mRNA. Translation: AAH70040.1.
    CCDSiCCDS53816.1. [Q9H2J7-3]
    CCDS9026.1. [Q9H2J7-1]
    CCDS9027.1. [Q9H2J7-2]
    RefSeqiNP_001139807.1. NM_001146335.2. [Q9H2J7-3]
    NP_060527.2. NM_018057.6. [Q9H2J7-2]
    NP_877499.1. NM_182767.5. [Q9H2J7-1]
    UniGeneiHs.44424.
    Hs.680104.

    Genome annotation databases

    EnsembliENST00000266682; ENSP00000266682; ENSG00000072041. [Q9H2J7-1]
    ENST00000450363; ENSP00000390706; ENSG00000072041. [Q9H2J7-2]
    ENST00000552192; ENSP00000450145; ENSG00000072041. [Q9H2J7-3]
    GeneIDi55117.
    KEGGihsa:55117.
    UCSCiuc001szv.5. human. [Q9H2J7-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AF265577 mRNA. Translation: AAG41361.1.
    AK022853 mRNA. Translation: BAB14274.1.
    AK291207 mRNA. Translation: BAF83896.1.
    AK294945 mRNA. Translation: BAH11933.1.
    AC018922 Genomic DNA. No translation available.
    AC128657 Genomic DNA. No translation available.
    CH471054 Genomic DNA. Translation: EAW97389.1.
    BC070040 mRNA. Translation: AAH70040.1.
    CCDSiCCDS53816.1. [Q9H2J7-3]
    CCDS9026.1. [Q9H2J7-1]
    CCDS9027.1. [Q9H2J7-2]
    RefSeqiNP_001139807.1. NM_001146335.2. [Q9H2J7-3]
    NP_060527.2. NM_018057.6. [Q9H2J7-2]
    NP_877499.1. NM_182767.5. [Q9H2J7-1]
    UniGeneiHs.44424.
    Hs.680104.

    3D structure databases

    ProteinModelPortaliQ9H2J7.
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi120426. 27 interactors.
    IntActiQ9H2J7. 2 interactors.
    STRINGi9606.ENSP00000266682.

    Chemistry databases

    BindingDBiQ9H2J7.
    ChEMBLiCHEMBL3351189.
    GuidetoPHARMACOLOGYi940.

    Protein family/group databases

    TCDBi2.A.22.6.7. the neurotransmitter:sodium symporter (nss) family.

    PTM databases

    iPTMnetiQ9H2J7.
    PhosphoSitePlusiQ9H2J7.

    Polymorphism and mutation databases

    BioMutaiSLC6A15.
    DMDMi18202939.

    Proteomic databases

    EPDiQ9H2J7.
    MaxQBiQ9H2J7.
    PaxDbiQ9H2J7.
    PeptideAtlasiQ9H2J7.
    PRIDEiQ9H2J7.

    Protocols and materials databases

    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000266682; ENSP00000266682; ENSG00000072041. [Q9H2J7-1]
    ENST00000450363; ENSP00000390706; ENSG00000072041. [Q9H2J7-2]
    ENST00000552192; ENSP00000450145; ENSG00000072041. [Q9H2J7-3]
    GeneIDi55117.
    KEGGihsa:55117.
    UCSCiuc001szv.5. human. [Q9H2J7-1]

    Organism-specific databases

    CTDi55117.
    DisGeNETi55117.
    GeneCardsiSLC6A15.
    HGNCiHGNC:13621. SLC6A15.
    HPAiHPA008609.
    MIMi607971. gene.
    neXtProtiNX_Q9H2J7.
    OpenTargetsiENSG00000072041.
    PharmGKBiPA37799.
    GenAtlasiSearch...

    Phylogenomic databases

    eggNOGiKOG3659. Eukaryota.
    COG0733. LUCA.
    GeneTreeiENSGT00760000119044.
    HOGENOMiHOG000116406.
    HOVERGENiHBG071421.
    InParanoidiQ9H2J7.
    KOiK05048.
    OMAiAWVVVCL.
    OrthoDBiEOG091G08PX.
    PhylomeDBiQ9H2J7.
    TreeFamiTF352709.

    Enzyme and pathway databases

    BioCyciZFISH:ENSG00000072041-MONOMER.
    ReactomeiR-HSA-352230. Amino acid transport across the plasma membrane.
    R-HSA-442660. Na+/Cl- dependent neurotransmitter transporters.

    Miscellaneous databases

    ChiTaRSiSLC6A15. human.
    GeneWikiiSLC6A15.
    GenomeRNAii55117.
    PROiQ9H2J7.
    SOURCEiSearch...

    Gene expression databases

    BgeeiENSG00000072041.
    CleanExiHS_SLC6A15.
    ExpressionAtlasiQ9H2J7. baseline and differential.
    GenevisibleiQ9H2J7. HS.

    Family and domain databases

    InterProiIPR000175. Na/ntran_symport.
    IPR002438. Na/ntran_symport_orphan.
    [Graphical view]
    PANTHERiPTHR11616. PTHR11616. 2 hits.
    PfamiPF00209. SNF. 1 hit.
    [Graphical view]
    PRINTSiPR00176. NANEUSMPORT.
    PR01206. ORPHTRNSPORT.
    PROSITEiPS00610. NA_NEUROTRAN_SYMP_1. 1 hit.
    PS00754. NA_NEUROTRAN_SYMP_2. 1 hit.
    PS50267. NA_NEUROTRAN_SYMP_3. 1 hit.
    [Graphical view]
    ProtoNetiSearch...

    Entry informationi

    Entry nameiS6A15_HUMAN
    AccessioniPrimary (citable) accession number: Q9H2J7
    Secondary accession number(s): A8K592
    , B7Z2P7, E7ESJ5, Q9H9F5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 26, 2001
    Last sequence update: March 1, 2001
    Last modified: November 2, 2016
    This is version 134 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    Similar proteinsi

    Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
    100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
    90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
    50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.