Q9H2J7 (S6A15_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 100.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sodium-dependent neutral amino acid transporter B(0)AT2 Alternative name(s): Sodium- and chloride-dependent neurotransmitter transporter NTT73 Sodium-coupled branched-chain amino-acid transporter 1 Solute carrier family 6 member 15 Transporter v7-3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 730 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Functions as a sodium-dependent neutral amino acid transporter. Exhibits preference for the branched-chain amino acids, particularly leucine, valine and isoleucine and methionine. Mediates the saturable, pH-sensitive and electrogenic cotransport of proline and sodium ions with a stoichiometry of 1:1. May have a role as transporter for neurotransmitter precursors into neurons. In contrast to other members of the neurotransmitter transporter family, does not appear to be chloride-dependent. Ref.6 |
| Subcellular location | Membrane; Multi-pass membrane protein Probable. |
| Tissue specificity | Almost exclusively expressed in the brain. Ref.6 |
| Sequence similarities | Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A15 subfamily. [View classification] |
| Biophysicochemical properties | Kinetic parameters: KM=0.16 mM for L-leucine (at pH 7.5, 100 mM NaCL, -70 mV) Ref.6 KM=0.16 mM for L-valine (at pH 7.5, 100 mM NaCL, -70 mV)) KM=0.08 mM for L-isoleucine (at pH 7.5, 100 mM NaCL, -70 mV) KM=0.11 mM for L-methionine (at pH 7.5, 100 mM NaCL, -70 mV) KM=0.38 mM for L-proline (at pH 7.5, 100 mM NaCL, -70 mV) pH dependence: Optimum pH is 7.5-8.5. Strongly inhibited at acidic PH. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9H2J7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9H2J7-2) The sequence of this isoform differs from the canonical sequence as follows: 253-289: IIYFSSLFPYVVLICFLIRAFLLNGSIDGIRHMFTPK → VSMLEPFLILLITISGFIPLSNSVTDFCGQITHNTSF 290-730: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9H2J7-3) The sequence of this isoform differs from the canonical sequence as follows: 1-107: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 730 | 730 | Sodium-dependent neutral amino acid transporter B(0)AT2 | PRO_0000214798 | |||||
Regions | |||||||||
| Topological domain | 1 – 69 | 69 | Cytoplasmic Potential | ||||||
| Transmembrane | 70 – 90 | 21 | Helical; Name=1; Potential | ||||||
| Transmembrane | 98 – 117 | 20 | Helical; Name=2; Potential | ||||||
| Transmembrane | 142 – 162 | 21 | Helical; Name=3; Potential | ||||||
| Topological domain | 163 – 225 | 63 | Extracellular Potential | ||||||
| Transmembrane | 226 – 244 | 19 | Helical; Name=4; Potential | ||||||
| Transmembrane | 253 – 270 | 18 | Helical; Name=5; Potential | ||||||
| Transmembrane | 306 – 323 | 18 | Helical; Name=6; Potential | ||||||
| Transmembrane | 335 – 356 | 22 | Helical; Name=7; Potential | ||||||
| Topological domain | 357 – 452 | 96 | Extracellular Potential | ||||||
| Transmembrane | 453 – 472 | 20 | Helical; Name=8; Potential | ||||||
| Transmembrane | 496 – 514 | 19 | Helical; Name=9; Potential | ||||||
| Transmembrane | 530 – 550 | 21 | Helical; Name=10; Potential | ||||||
| Transmembrane | 571 – 592 | 22 | Helical; Name=11; Potential | ||||||
| Transmembrane | 620 – 642 | 23 | Helical; Name=12; Potential | ||||||
| Topological domain | 643 – 730 | 88 | Cytoplasmic Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 55 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 687 | 1 | Phosphoserine Ref.7 | ||||||
| Glycosylation | 187 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 213 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 383 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 394 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 107 | 107 | Missing in isoform 3. | VSP_045192 | |||||
| Alternative sequence | 253 – 289 | 37 | IIYFS…MFTPK → VSMLEPFLILLITISGFIPL SNSVTDFCGQITHNTSF in isoform 2. | VSP_043030 | |||||
| Alternative sequence | 290 – 730 | 441 | Missing in isoform 2. | VSP_043031 | |||||
| Natural variant | 400 | 1 | A → V. Ref.2 Corresponds to variant rs12424429 [ dbSNP | Ensembl ]. | VAR_052065 | |||||
| Natural variant | 603 | 1 | I → M. Corresponds to variant rs3782369 [ dbSNP | Ensembl ]. | VAR_052066 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of human NTT5 and v7-3: two orphan transporters of the Na(+)/Cl(-)-dependent neurotransmitter transporter gene family." Farmer M.K., Robbins M.J., Medhurst A.D., Campbell D.A., Ellington K., Duckworth M., Brown A.M., Middlemiss D.N., Price G.W., Pangalos M.N. Genomics 70:241-252(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Cerebellum. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), VARIANT VAL-400. Tissue: Brain. |
| [3] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Placenta. |
| [6] | "Characterization of a branched-chain amino-acid transporter SBAT1 (SLC6A15) that is expressed in human brain." Takanaga H., Mackenzie B., Peng J.B., Hediger M.A. Biochem. Biophys. Res. Commun. 337:892-900(2005) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, FUNCTION, BIOPHYSICOCHEMICAL PROPERTIES. |
| [7] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-55 AND SER-687, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [9] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF265577 mRNA. Translation: AAG41361.1. AK022853 mRNA. Translation: BAB14274.1. AK291207 mRNA. Translation: BAF83896.1. AK294945 mRNA. Translation: BAH11933.1. AC018922 Genomic DNA. No translation available. AC128657 Genomic DNA. No translation available. CH471054 Genomic DNA. Translation: EAW97389.1. BC070040 mRNA. Translation: AAH70040.1. |
| IPI | IPI00018071. IPI00165147. IPI00746124. |
| RefSeq | NP_001139807.1. NM_001146335.2. NP_060527.2. NM_018057.6. NP_877499.1. NM_182767.5. |
| UniGene | Hs.44424. |
3D structure databases | |
| ProteinModelPortal | Q9H2J7. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000266682. |
PTM databases | |
| PhosphoSite | Q9H2J7. |
Polymorphism databases | |
| DMDM | 18202939. |
Proteomic databases | |
| PaxDb | Q9H2J7. |
| PRIDE | Q9H2J7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000266682; ENSP00000266682; ENSG00000072041. ENST00000450363; ENSP00000390706; ENSG00000072041. ENST00000552192; ENSP00000450145; ENSG00000072041. |
| GeneID | 55117. |
| KEGG | hsa:55117. |
| UCSC | uc001szv.3. human. |
Organism-specific databases | |
| CTD | 55117. |
| GeneCards | GC12M085253. |
| HGNC | HGNC:13621. SLC6A15. |
| HPA | HPA008609. |
| MIM | 607971. gene. |
| neXtProt | NX_Q9H2J7. |
| PharmGKB | PA37799. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0733. |
| HOGENOM | HOG000116406. |
| HOVERGEN | HBG071421. |
| InParanoid | Q9H2J7. |
| KO | K05048. |
| OMA | NSCQIED. |
| OrthoDB | EOG4N04DJ. |
| PhylomeDB | Q9H2J7. |
Enzyme and pathway databases | |
| Reactome | REACT_15518. Transmembrane transport of small molecules. REACT_19419. Amino acid and oligopeptide SLC transporters. REACT_20679. Amine compound SLC transporters. |
Gene expression databases | |
| ArrayExpress | Q9H2J7. |
| Bgee | Q9H2J7. |
| CleanEx | HS_SLC6A15. |
| Genevestigator | Q9H2J7. |
| GermOnline | ENSG00000072041. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000175. Na/ntran_symport. IPR002438. Na/ntran_symport_orphan. [Graphical view] |
| PANTHER | PTHR11616. PTHR11616. 1 hit. |
| Pfam | PF00209. SNF. 1 hit. [Graphical view] |
| PRINTS | PR00176. NANEUSMPORT. PR01206. ORPHTRNSPORT. |
| PROSITE | PS00610. NA_NEUROTRAN_SYMP_1. 1 hit. PS00754. NA_NEUROTRAN_SYMP_2. 1 hit. PS50267. NA_NEUROTRAN_SYMP_3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SLC6A15. human. |
| GenomeRNAi | 55117. |
| NextBio | 58754. |
| SOURCE | Search... |
Entry information
| Entry name | S6A15_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H2J7 Secondary accession number(s): A8K592 Q9H9F5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
