Q9H2H8 (PPIL3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 100.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Peptidyl-prolyl cis-trans isomerase-like 3 Short name=PPIase EC=5.2.1.8 Alternative name(s): Cyclophilin J Short name=CyPJ Cyclophilin-like protein PPIL3 Rotamase PPIL3 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 161 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. May be involved in pre-mRNA splicing. |
| Catalytic activity | Peptidylproline (omega=180) = peptidylproline (omega=0). |
| Subunit structure | Identified in the spliceosome C complex. Ref.6 |
| Tissue specificity | Ubiquitous. Detected at low levels. Ref.1 |
| Sequence similarities | Belongs to the cyclophilin-type PPIase family. PPIL3 subfamily. Contains 1 PPIase cyclophilin-type domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | mRNA processing mRNA splicing |
| Cellular component | Spliceosome |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Molecular function | Isomerase Rotamase |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | mRNA splicing, via spliceosome Inferred by curator Ref.6. Source: UniProtKB protein foldingInferred from electronic annotation. Source: UniProtKB-KW protein peptidyl-prolyl isomerizationInferred from electronic annotation. Source: GOC |
| Cellular_component | catalytic step 2 spliceosome Inferred from direct assay Ref.6. Source: UniProtKB |
| Molecular_function | peptidyl-prolyl cis-trans isomerase activity Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| VP3 | Q99152 | 3 | EBI-751051,EBI-1776808 | From a different organism. |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9H2H8-1) Also known as: PPIL3b; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9H2H8-2) Also known as: PPIL3a; The sequence of this isoform differs from the canonical sequence as follows: 27-58: NFLALCASNYYNGCIFHRNIKGFMVQTGDPTG → MESRCVPQAGVQWRDLGSLQPPPPGFKQVFCLSLPR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 161 | 161 | Peptidyl-prolyl cis-trans isomerase-like 3 | PRO_0000064166 | |||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||
| Domain | 1 – 154 | 154 | PPIase cyclophilin-type | ||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 27 – 58 | 32 | NFLAL…GDPTG → MESRCVPQAGVQWRDLGSLQ PPPPGFKQVFCLSLPR in isoform 2. | VSP_015468 | |||||||||||||||||||||||||||||||||||||||
| Natural variant | 146 | 1 | D → E. Ref.5 Corresponds to variant rs7562391 [ dbSNP | Ensembl ]. | VAR_023417 | |||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 61 – 62 | 2 | RG → KR in AAO64723. Ref.2 | ||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 65 | 1 | S → V in AAO64723. Ref.2 | ||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 78 | 1 | Y → I in AAO64723. Ref.2 | ||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 2 – 7 | 6 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 10 – 16 | 7 | |||||||||||||||||||||||||||||||||||||||||
| Turn | 18 – 20 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 22 – 33 | 12 | |||||||||||||||||||||||||||||||||||||||||
| Turn | 34 – 39 | 6 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 44 – 46 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Turn | 47 – 49 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 50 – 53 | 4 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 58 – 61 | 4 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 86 – 89 | 4 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 92 – 95 | 4 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 101 – 106 | 6 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 109 – 111 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Turn | 112 – 114 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 117 – 123 | 7 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 125 – 132 | 8 | |||||||||||||||||||||||||||||||||||||||||
| Turn | 138 – 140 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 143 – 145 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 148 – 155 | 8 | |||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and characterization of a novel peptidylprolyl isomerase (cyclophilin)-like gene (PPIL3) from human fetal brain." Zhou Z., Ying K., Dai J., Tang R., Wang W., Huang Y., Zhao W., Xie Y., Mao Y. Cytogenet. Cell Genet. 92:231-236(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY. Tissue: Fetal brain. |
| [2] | Ding J.B., Yu L., Zhao S.Y. Submitted (APR-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Embryo. |
| [4] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLU-146. Tissue: Placenta. |
| [6] | "Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis." Jurica M.S., Licklider L.J., Gygi S.P., Grigorieff N., Moore M.J. RNA 8:426-439(2002) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE SPLICEOSOMAL C COMPLEX. |
| [7] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [8] | "Structure of recombinant human cyclophilin J, a novel member of the cyclophilin family." Huang L.-L., Zhao X.-M., Huang C.-Q., Yu L., Xia Z.-X. Acta Crystallogr. D 61:316-321(2005) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS). |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF251049 mRNA. Translation: AAK34939.1. AF271652 mRNA. Translation: AAG44766.1. AF146799 mRNA. Translation: AAO64723.1. AK027315 mRNA. Translation: BAB55036.1. AC005037 Genomic DNA. Translation: AAY14723.1. BC007693 mRNA. Translation: AAH07693.1. | ||||||||||||||||||||||||
| IPI | IPI00032473. IPI00300952. | ||||||||||||||||||||||||
| RefSeq | NP_115861.1. NM_032472.3. NP_570981.1. NM_130906.2. | ||||||||||||||||||||||||
| UniGene | Hs.121076. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | Q9H2H8. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| IntAct | Q9H2H8. 2 interactions. | ||||||||||||||||||||||||
| STRING | 9606.ENSP00000286175. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q9H2H8. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 73921766. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | Q9H2H8. | ||||||||||||||||||||||||
| PRIDE | Q9H2H8. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| DNASU | 53938. | ||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000286175; ENSP00000286175; ENSG00000240344. ENST00000392283; ENSP00000376107; ENSG00000240344. ENST00000409449; ENSP00000387012; ENSG00000240344. | ||||||||||||||||||||||||
| GeneID | 53938. | ||||||||||||||||||||||||
| KEGG | hsa:53938. | ||||||||||||||||||||||||
| UCSC | uc002uwh.3. human. uc002uwi.3. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 53938. | ||||||||||||||||||||||||
| GeneCards | GC02M201737. | ||||||||||||||||||||||||
| HGNC | HGNC:9262. PPIL3. | ||||||||||||||||||||||||
| HPA | HPA040765. | ||||||||||||||||||||||||
| neXtProt | NX_Q9H2H8. | ||||||||||||||||||||||||
| PharmGKB | PA33589. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | COG0652. | ||||||||||||||||||||||||
| HOGENOM | HOG000065981. | ||||||||||||||||||||||||
| HOVERGEN | HBG001065. | ||||||||||||||||||||||||
| KO | K12734. | ||||||||||||||||||||||||
| OrthoDB | EOG43XV4M. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| BRENDA | 5.2.1.8. 2681. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q9H2H8. | ||||||||||||||||||||||||
| Bgee | Q9H2H8. | ||||||||||||||||||||||||
| CleanEx | HS_PPIL3. | ||||||||||||||||||||||||
| Genevestigator | Q9H2H8. | ||||||||||||||||||||||||
| GermOnline | ENSG00000115934. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR002130. Cyclophilin-like_PPIase_dom. IPR024936. Cyclophilin-type_PPIase. IPR020892. Cyclophilin-type_PPIase_CS. [Graphical view] | ||||||||||||||||||||||||
| Pfam | PF00160. Pro_isomerase. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PIRSF | PIRSF001467. Peptidylpro_ismrse. 1 hit. | ||||||||||||||||||||||||
| PRINTS | PR00153. CSAPPISMRASE. | ||||||||||||||||||||||||
| SUPFAM | SSF50891. CSA_PPIase. 1 hit. | ||||||||||||||||||||||||
| PROSITE | PS00170. CSA_PPIASE_1. 1 hit. PS50072. CSA_PPIASE_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| ChiTaRS | PPIL3. human. | ||||||||||||||||||||||||
| EvolutionaryTrace | Q9H2H8. | ||||||||||||||||||||||||
| GenomeRNAi | 53938. | ||||||||||||||||||||||||
| NextBio | 56240. | ||||||||||||||||||||||||
Entry information
| Entry name | PPIL3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H2H8 Secondary accession number(s): Q86WF9, Q96IA9, Q9BXZ1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
