Reviewed,
UniProtKB/Swiss-Prot Q9H2H8 (PPIL3_HUMAN)
Last modified
November 3, 2009.
Version 68.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Peptidyl-prolyl cis-trans isomerase-like 3 Short name=PPIase Short name=Rotamase EC=5.2.1.8 Alternative name(s): Cyclophilin-like protein PPIL3 Cyclophilin J Short name=CyPJ | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 161 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. May be involved in pre-mRNA splicing. |
| Catalytic activity | Peptidylproline (omega=180) = peptidylproline (omega=0). |
| Subunit structure | Identified in the spliceosome C complex, at least composed of AQR, ASCC3L1, C19orf29, CDC40, CDC5L, CRNKL1, DDX23, DDX41, DDX48, DDX5, DGCR14, DHX35, DHX38, DHX8, EFTUD2, FRG1, GPATC1, HNRPA1, HNRPA2B1, HNRPA3, HNRPC, HNRPF, HNRPH1, HNRPK, HNRPM, HNRPR, HNRPU, KIAA1160, KIAA1604, LSM2, LSM3, MAGOH, MORG1, PABPC1, PLRG1, PNN, PPIE, PPIL1, PPIL3, PPWD1, PRPF19, PRPF4B, PRPF6, PRPF8, RALY, RBM22, RBM8A, RBMX, SART1, SF3A1, SF3A2, SF3A3, SF3B1, SF3B2, SF3B3, SFRS1, SKIV2L2, SNRPA1, SNRPB, SNRPB2, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF, SNRPG, SNW1, SRRM1, SRRM2, SYF2, SYNCRIP, TFIP11, THOC4, U2AF1, WDR57, XAB2 and ZCCHC8. |
| Tissue specificity | Ubiquitous. Detected at low levels. Ref.1 |
| Sequence similarities | Belongs to the cyclophilin-type PPIase family. PPIL3 subfamily. Contains 1 PPIase cyclophilin-type domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | mRNA processing mRNA splicing |
| Cellular component | Spliceosome |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Molecular function | Isomerase Rotamase |
| Technical term | 3D-structure Complete proteome |
| Gene Ontology (GO) | |
| Biological process | RNA splicing Inferred from electronic annotation. Source: UniProtKB-KW mRNA processingInferred from electronic annotation. Source: UniProtKB-KW protein foldingInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | spliceosomal complex Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | peptidyl-prolyl cis-trans isomerase activity Inferred from electronic annotation. Source: UniProtKB-KW protein bindingInferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| VP3 | Q99152 | 1 | EBI-751051,EBI-1776808 | From a different organism. |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9H2H8-1) Also known as: PPIL3b; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9H2H8-2) Also known as: PPIL3a; The sequence of this isoform differs from the canonical sequence as follows: 27-58: NFLALCASNYYNGCIFHRNIKGFMVQTGDPTG → MESRCVPQAGVQWRDLGSLQPPPPGFKQVFCLSLPR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 161 | 161 | Peptidyl-prolyl cis-trans isomerase-like 3 | PRO_0000064166 | |||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||
| Domain | 1 – 154 | 154 | PPIase cyclophilin-type | ||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 27 – 58 | 32 | NFLAL…GDPTG → MESRCVPQAGVQWRDLGSLQ PPPPGFKQVFCLSLPR in isoform 2. | VSP_015468 | |||||||||||||||||||||||||||||||||||||||
| Natural variant | 146 | 1 | D → E: dbSNP rs7562391. Ref.5 | VAR_023417 | |||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 61 – 62 | 2 | RG → KR in AAO64723. Ref.2 | ||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 65 | 1 | S → V in AAO64723. Ref.2 | ||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 78 | 1 | Y → I in AAO64723. Ref.2 | ||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 2 – 7 | 6 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 10 – 16 | 7 | |||||||||||||||||||||||||||||||||||||||||
| Turn | 18 – 20 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 22 – 33 | 12 | |||||||||||||||||||||||||||||||||||||||||
| Turn | 34 – 39 | 6 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 44 – 46 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Turn | 47 – 49 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 50 – 53 | 4 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 58 – 61 | 4 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 86 – 89 | 4 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 92 – 95 | 4 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 101 – 106 | 6 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 109 – 111 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Turn | 112 – 114 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 117 – 123 | 7 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 125 – 132 | 8 | |||||||||||||||||||||||||||||||||||||||||
| Turn | 138 – 140 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 143 – 145 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 148 – 155 | 8 | |||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and characterization of a novel peptidylprolyl isomerase (cyclophilin)-like gene (PPIL3) from human fetal brain." Zhou Z., Ying K., Dai J., Tang R., Wang W., Huang Y., Zhao W., Xie Y., Mao Y. Cytogenet. Cell Genet. 92:231-236(2001) [PubMed: 11435694] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY. Tissue: Fetal brain. |
| [2] | Ding J.B., Yu L., Zhao S.Y. Submitted (APR-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Embryo. |
| [4] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLU-146. Tissue: Placenta. |
| [6] | "Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis." Jurica M.S., Licklider L.J., Gygi S.P., Grigorieff N., Moore M.J. RNA 8:426-439(2002) [PubMed: 11991638] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE SPICEOSOMAL C COMPLEX. |
| [7] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [8] | "Structure of recombinant human cyclophilin J, a novel member of the cyclophilin family." Huang L.-L., Zhao X.-M., Huang C.-Q., Yu L., Xia Z.-X. Acta Crystallogr. D 61:316-321(2005) [PubMed: 15735342] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS). |
| + | Additional computationally mapped references. |
Cross-references
Entry information
| Entry name | PPIL3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H2H8 Secondary accession number(s): Q86WF9, Q96IA9, Q9BXZ1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


