Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Enhancer of polycomb homolog 1

Gene

EPC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage.1 Publication

GO - Biological processi

  • histone H2A acetylation Source: UniProtKB
  • histone H4 acetylation Source: UniProtKB
  • negative regulation of gene expression, epigenetic Source: MGI
  • negative regulation of transcription, DNA-templated Source: UniProtKB
  • negative regulation of transcription from RNA polymerase II promoter Source: MGI
  • positive regulation of transcription, DNA-templated Source: UniProtKB
  • positive regulation of transcription from RNA polymerase II promoter Source: MGI
  • regulation of growth Source: UniProtKB-KW
  • transcription, DNA-templated Source: UniProtKB
  • vascular smooth muscle cell differentiation Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Activator, Chromatin regulator

Keywords - Biological processi

Growth regulation, Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-HSA-3214847. HATs acetylate histones.

Names & Taxonomyi

Protein namesi
Recommended name:
Enhancer of polycomb homolog 1
Gene namesi
Name:EPC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:19876. EPC1.

Subcellular locationi

  • Nucleus 1 Publication

GO - Cellular componenti

  • NuA4 histone acetyltransferase complex Source: UniProtKB
  • nuclear membrane Source: MGI
  • nucleoplasm Source: MGI
  • nucleus Source: UniProtKB
  • Piccolo NuA4 histone acetyltransferase complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134981141.

Polymorphism and mutation databases

DMDMi59797889.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 836836Enhancer of polycomb homolog 1PRO_0000214153Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei539 – 5391PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9H2F5.
MaxQBiQ9H2F5.
PaxDbiQ9H2F5.
PeptideAtlasiQ9H2F5.
PRIDEiQ9H2F5.

PTM databases

iPTMnetiQ9H2F5.
PhosphoSiteiQ9H2F5.
SwissPalmiQ9H2F5.

Expressioni

Gene expression databases

BgeeiENSG00000120616.
GenevisibleiQ9H2F5. HS.

Interactioni

Subunit structurei

Component of the NuA4 histone acetyltransferase complex which contains the catalytic subunit KAT5/TIP60 and the subunits EP400, TRRAP/PAF400, BRD8/SMAP, EPC1, DMAP1/DNMAP1, RUVBL1/TIP49, RUVBL2, ING3, actin, ACTL6A/BAF53A, MORF4L1/MRG15, MORF4L2/MRGX, MRGBP, YEATS4/GAS41, VPS72/YL1 and MEAF6. HTATTIP/TIP60, EPC1, and ING3 together constitute a minimal HAT complex termed Piccolo NuA4. Component of a NuA4-related complex which contains EP400, TRRAP/PAF400, SRCAP, BRD8/SMAP, EPC1, DMAP1/DNMAP1, RUVBL1/TIP49, RUVBL2, actin, ACTL6A/BAF53A, VPS72 and YEATS4/GAS41. The NuA4 complex interacts with MYC and the adenovirus E1A protein. EPC1 interacts with TRIM27.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
KRT15P190123EBI-769270,EBI-739566
RINT1Q6NUQ14EBI-769270,EBI-726876

Protein-protein interaction databases

BioGridi123227. 31 interactions.
IntActiQ9H2F5. 15 interactions.
STRINGi9606.ENSP00000263062.

Structurei

3D structure databases

ProteinModelPortaliQ9H2F5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the enhancer of polycomb family.Curated

Phylogenomic databases

eggNOGiKOG2261. Eukaryota.
ENOG410XSSX. LUCA.
GeneTreeiENSGT00390000013262.
HOVERGENiHBG051489.
InParanoidiQ9H2F5.
KOiK11322.
OMAiALSHQVT.
OrthoDBiEOG091G0252.
PhylomeDBiQ9H2F5.
TreeFamiTF106438.

Family and domain databases

InterProiIPR024943. Enhancer_polycomb.
IPR019542. Enhancer_polycomb-like_N.
IPR009607. Enhancer_polycomb_C.
[Graphical view]
PANTHERiPTHR14898. PTHR14898. 1 hit.
PfamiPF06752. E_Pc_C. 1 hit.
PF10513. EPL1. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H2F5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSKLSFRARA LDASKPLPVF RCEDLPDLHE YASINRAVPQ MPTGMEKEEE
60 70 80 90 100
SEHHLQRAIS AQQVYGEKRD NMVIPVPEAE SNIAYYESIY PGEFKMPKQL
110 120 130 140 150
IHIQPFSLDA EQPDYDLDSE DEVFVNKLKK KMDICPLQFE EMIDRLEKGS
160 170 180 190 200
GQQPVSLQEA KLLLKEDDEL IREVYEYWIK KRKNCRGPSL IPSVKQEKRD
210 220 230 240 250
GSSTNDPYVA FRRRTEKMQT RKNRKNDEAS YEKMLKLRRD LSRAVTILEM
260 270 280 290 300
IKRREKSKRE LLHLTLEIME KRYNLGDYNG EIMSEVMAQR QPMKPTYAIP
310 320 330 340 350
IIPITNSSQF KHQEAMDVKE FKVNKQDKAD LIRPKRKYEK KPKVLPSSAA
360 370 380 390 400
ATPQQTSPAA LPVFNAKDLN QYDFPSSDEE PLSQVLSGSS EAEEDNDPDG
410 420 430 440 450
PFAFRRKAGC QYYAPHLDQT GNWPWTSPKD GGLGDVRYRY CLTTLTVPQR
460 470 480 490 500
CIGFARRRVG RGGRVLLDRA HSDYDSVFHH LDLEMLSSPQ HSPVNQFANT
510 520 530 540 550
SETNTSDKSF SKDLSQILVN IKSCRWRHFR PRTPSLHDSD NDELSCRKLY
560 570 580 590 600
RSINRTGTAQ PGTQTCSTST QSKSSSGSAH FAFTAEQYQQ HQQQLALMQK
610 620 630 640 650
QQLAQIQQQQ ANSNSSTNTS QNLASNQQKS GFRLNIQGLE RTLQGFVSKT
660 670 680 690 700
LDSASAQFAA SALVTSEQLM GFKMKDDVVL GIGVNGVLPA SGVYKGLHLS
710 720 730 740 750
STTPTALVHT SPSTAGSALL QPSNITQTSS SHSALSHQVT AANSATTQVL
760 770 780 790 800
IGNNIRLTVP SSVATVNSIA PINARHIPRT LSAVPSSALK LAAAANCQVS
810 820 830
KVPSSSSVDS VPRENHESEK PALNNIADNT VAMEVT
Length:836
Mass (Da):93,463
Last modified:March 1, 2001 - v1
Checksum:iE9E89699E73336B5
GO
Isoform 2 (identifier: Q9H2F5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     621-643: Missing.

Show »
Length:813
Mass (Da):90,865
Checksum:iAD6AE9D14C3020A7
GO
Isoform 3 (identifier: Q9H2F5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MSKLSFRARALDASKPLPVFRCEDLPDLHEYASINRAVPQMPTGMEKEEES → M
     621-643: Missing.

Show »
Length:763
Mass (Da):85,222
Checksum:i9AAF6D3B2C0E3840
GO

Sequence cautioni

The sequence BAB14888 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAC03857 differs from that shown.Unlikely isoform. Aberrant splice sites.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti156 – 1561S → G in AAK60501 (Ref. 2) Curated
Sequence conflicti256 – 2561K → R in AAK60501 (Ref. 2) Curated
Sequence conflicti783 – 7831A → V in AAH36529 (PubMed:15489334).Curated
Sequence conflicti825 – 8251N → S in BAC03857 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti123 – 1231V → L.1 Publication
VAR_074181

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5151MSKLS…KEEES → M in isoform 3. 2 PublicationsVSP_012875Add
BLAST
Alternative sequencei621 – 64323Missing in isoform 2 and isoform 3. 3 PublicationsVSP_012877Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF277374 mRNA. Translation: AAG41402.1.
AF286905 mRNA. Translation: AAK60501.1.
AK024329 mRNA. Translation: BAB14888.1. Different initiation.
AK092304 mRNA. Translation: BAC03857.1. Sequence problems.
AK299676 mRNA. Translation: BAG61585.1.
AL158834, AL391839 Genomic DNA. Translation: CAH70821.1.
AL158834, AL391839 Genomic DNA. Translation: CAH70822.1.
AL158834, AL391839 Genomic DNA. Translation: CAH70823.1.
AL391839, AL158834 Genomic DNA. Translation: CAH70453.1.
AL391839, AL158834 Genomic DNA. Translation: CAH70454.1.
AL391839, AL158834 Genomic DNA. Translation: CAH70455.1.
CH471072 Genomic DNA. Translation: EAW85972.1.
CH471072 Genomic DNA. Translation: EAW85973.1.
BC036529 mRNA. Translation: AAH36529.1.
CCDSiCCDS60511.1. [Q9H2F5-2]
CCDS7172.1. [Q9H2F5-1]
CCDS73083.1. [Q9H2F5-3]
RefSeqiNP_001258933.1. NM_001272004.1. [Q9H2F5-2]
NP_001258948.1. NM_001272019.2.
NP_001269320.1. NM_001282391.1. [Q9H2F5-3]
NP_079485.1. NM_025209.3. [Q9H2F5-1]
UniGeneiHs.167805.

Genome annotation databases

EnsembliENST00000263062; ENSP00000263062; ENSG00000120616. [Q9H2F5-1]
ENST00000319778; ENSP00000318559; ENSG00000120616. [Q9H2F5-2]
ENST00000375110; ENSP00000364251; ENSG00000120616. [Q9H2F5-3]
GeneIDi80314.
KEGGihsa:80314.
UCSCiuc001iwg.3. human. [Q9H2F5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF277374 mRNA. Translation: AAG41402.1.
AF286905 mRNA. Translation: AAK60501.1.
AK024329 mRNA. Translation: BAB14888.1. Different initiation.
AK092304 mRNA. Translation: BAC03857.1. Sequence problems.
AK299676 mRNA. Translation: BAG61585.1.
AL158834, AL391839 Genomic DNA. Translation: CAH70821.1.
AL158834, AL391839 Genomic DNA. Translation: CAH70822.1.
AL158834, AL391839 Genomic DNA. Translation: CAH70823.1.
AL391839, AL158834 Genomic DNA. Translation: CAH70453.1.
AL391839, AL158834 Genomic DNA. Translation: CAH70454.1.
AL391839, AL158834 Genomic DNA. Translation: CAH70455.1.
CH471072 Genomic DNA. Translation: EAW85972.1.
CH471072 Genomic DNA. Translation: EAW85973.1.
BC036529 mRNA. Translation: AAH36529.1.
CCDSiCCDS60511.1. [Q9H2F5-2]
CCDS7172.1. [Q9H2F5-1]
CCDS73083.1. [Q9H2F5-3]
RefSeqiNP_001258933.1. NM_001272004.1. [Q9H2F5-2]
NP_001258948.1. NM_001272019.2.
NP_001269320.1. NM_001282391.1. [Q9H2F5-3]
NP_079485.1. NM_025209.3. [Q9H2F5-1]
UniGeneiHs.167805.

3D structure databases

ProteinModelPortaliQ9H2F5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123227. 31 interactions.
IntActiQ9H2F5. 15 interactions.
STRINGi9606.ENSP00000263062.

PTM databases

iPTMnetiQ9H2F5.
PhosphoSiteiQ9H2F5.
SwissPalmiQ9H2F5.

Polymorphism and mutation databases

DMDMi59797889.

Proteomic databases

EPDiQ9H2F5.
MaxQBiQ9H2F5.
PaxDbiQ9H2F5.
PeptideAtlasiQ9H2F5.
PRIDEiQ9H2F5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000263062; ENSP00000263062; ENSG00000120616. [Q9H2F5-1]
ENST00000319778; ENSP00000318559; ENSG00000120616. [Q9H2F5-2]
ENST00000375110; ENSP00000364251; ENSG00000120616. [Q9H2F5-3]
GeneIDi80314.
KEGGihsa:80314.
UCSCiuc001iwg.3. human. [Q9H2F5-1]

Organism-specific databases

CTDi80314.
GeneCardsiEPC1.
HGNCiHGNC:19876. EPC1.
MIMi610999. gene.
neXtProtiNX_Q9H2F5.
PharmGKBiPA134981141.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2261. Eukaryota.
ENOG410XSSX. LUCA.
GeneTreeiENSGT00390000013262.
HOVERGENiHBG051489.
InParanoidiQ9H2F5.
KOiK11322.
OMAiALSHQVT.
OrthoDBiEOG091G0252.
PhylomeDBiQ9H2F5.
TreeFamiTF106438.

Enzyme and pathway databases

ReactomeiR-HSA-3214847. HATs acetylate histones.

Miscellaneous databases

ChiTaRSiEPC1. human.
GeneWikiiEPC1.
GenomeRNAii80314.
PROiQ9H2F5.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000120616.
GenevisibleiQ9H2F5. HS.

Family and domain databases

InterProiIPR024943. Enhancer_polycomb.
IPR019542. Enhancer_polycomb-like_N.
IPR009607. Enhancer_polycomb_C.
[Graphical view]
PANTHERiPTHR14898. PTHR14898. 1 hit.
PfamiPF06752. E_Pc_C. 1 hit.
PF10513. EPL1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiEPC1_HUMAN
AccessioniPrimary (citable) accession number: Q9H2F5
Secondary accession number(s): B4DSC3
, D3DRX7, Q5VW54, Q5VW56, Q5VW58, Q8NAQ4, Q8NE21, Q96LF4, Q96RR6, Q9H7T7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: March 1, 2001
Last modified: September 7, 2016
This is version 131 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.