Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sulfate anion transporter 1

Gene

SLC26A1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

High affinity uptake of sulfate. Accepts oxalate, but not succinate as a cosubstrate. Mediates sulfate and oxalate transport.1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ion channel

Keywords - Biological processi

Anion exchange, Antiport, Ion transport, Transport

Enzyme and pathway databases

ReactomeiR-HSA-174362. Transport and synthesis of PAPS.
R-HSA-427601. Multifunctional anion exchangers.

Protein family/group databases

TCDBi2.A.53.2.16. the sulfate permease (sulp) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Sulfate anion transporter 1
Short name:
SAT-1
Alternative name(s):
Solute carrier family 26 member 1
Gene namesi
Name:SLC26A1
Synonyms:SAT1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:10993. SLC26A1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei68 – 9023HelicalSequence analysisAdd
BLAST
Transmembranei94 – 11623HelicalSequence analysisAdd
BLAST
Transmembranei176 – 19823HelicalSequence analysisAdd
BLAST
Transmembranei255 – 27723HelicalSequence analysisAdd
BLAST
Transmembranei290 – 30920HelicalSequence analysisAdd
BLAST
Transmembranei342 – 36423HelicalSequence analysisAdd
BLAST
Transmembranei377 – 39923HelicalSequence analysisAdd
BLAST
Transmembranei412 – 43423HelicalSequence analysisAdd
BLAST
Transmembranei472 – 49423HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

  • integral component of membrane Source: UniProtKB
  • integral component of plasma membrane Source: GO_Central
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA400.

Polymorphism and mutation databases

DMDMi209572674.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 701701Sulfate anion transporter 1PRO_0000080155Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi158 – 1581N-linked (GlcNAc...)Sequence analysis
Glycosylationi163 – 1631N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ9H2B4.
PaxDbiQ9H2B4.
PeptideAtlasiQ9H2B4.
PRIDEiQ9H2B4.

PTM databases

iPTMnetiQ9H2B4.
PhosphoSiteiQ9H2B4.

Expressioni

Tissue specificityi

Expressed most abundantly in the kidney and liver, with lower levels in the pancreas, testis, brain, small intestine, colon, and lung.1 Publication

Gene expression databases

BgeeiENSG00000145217.
CleanExiHS_SAT1.
HS_SLC26A1.
GenevisibleiQ9H2B4. HS.

Organism-specific databases

HPAiHPA041654.

Interactioni

Protein-protein interaction databases

BioGridi116071. 1 interaction.
STRINGi9606.ENSP00000354721.

Structurei

3D structure databases

ProteinModelPortaliQ9H2B4.
SMRiQ9H2B4. Positions 508-690.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini527 – 687161STASPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 STAS domain.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0236. Eukaryota.
COG0659. LUCA.
GeneTreeiENSGT00760000119026.
HOGENOMiHOG000006546.
HOVERGENiHBG000639.
InParanoidiQ9H2B4.
KOiK14700.
OMAiLPAFLHC.
OrthoDBiEOG091G07RT.
PhylomeDBiQ9H2B4.
TreeFamiTF313784.

Family and domain databases

Gene3Di3.30.750.24. 2 hits.
InterProiIPR018045. S04_transporter_CS.
IPR011547. SLC26A/SulP_dom.
IPR001902. SLC26A/SulP_fam.
IPR030331. SLC26A1.
IPR002645. STAS_dom.
[Graphical view]
PANTHERiPTHR11814. PTHR11814. 2 hits.
PTHR11814:SF31. PTHR11814:SF31. 2 hits.
PfamiPF01740. STAS. 1 hit.
PF00916. Sulfate_transp. 1 hit.
[Graphical view]
SUPFAMiSSF52091. SSF52091. 2 hits.
TIGRFAMsiTIGR00815. sulP. 1 hit.
PROSITEiPS01130. SLC26A. 1 hit.
PS50801. STAS. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H2B4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDESPEPLQQ GRGPVPVRRQ RPAPRGLREM LKARLWCSCS CSVLCVRALV
60 70 80 90 100
QDLLPATRWL RQYRPREYLA GDVMSGLVIG IILVPQAIAY SLLAGLQPIY
110 120 130 140 150
SLYTSFFANL IYFLMGTSRH VSVGIFSLLC LMVGQVVDRE LQLAGFDPSQ
160 170 180 190 200
DGLQPGANSS TLNGSAAMLD CGRDCYAIRV ATALTLMTGL YQVLMGVLRL
210 220 230 240 250
GFVSAYLSQP LLDGFAMGAS VTILTSQLKH LLGVRIPRHQ GPGMVVLTWL
260 270 280 290 300
SLLRGAGQAN VCDVVTSTVC LAVLLAAKEL SDRYRHRLRV PLPTELLVIV
310 320 330 340 350
VATLVSHFGQ LHKRFGSSVA GDIPTGFMPP QVPEPRLMQR VALDAVALAL
360 370 380 390 400
VAAAFSISLA EMFARSHGYS VRANQELLAV GCCNVLPAFL HCFATSAALA
410 420 430 440 450
KSLVKTATGC RTQLSSVVSA TVVLLVLLAL APLFHDLQRS VLACVIVVSL
460 470 480 490 500
RGALRKVWDL PRLWRMSPAD ALVWAGTAAT CMLVSTEAGL LAGVILSLLS
510 520 530 540 550
LAGRTQRPRT ALLARIGDTA FYEDATEFEG LVPEPGVRVF RFGGPLYYAN
560 570 580 590 600
KDFFLQSLYS LTGLDAGCMA ARRKEGGSET GVGEGGPAQG EDLGPVSTRA
610 620 630 640 650
ALVPAAAGFH TVVIDCAPLL FLDAAGVSTL QDLRRDYGAL GISLLLACCS
660 670 680 690 700
PPVRDILSRG GFLGEGPGDT AEEEQLFLSV HDAVQTARAR HRELEATDAH

L
Length:701
Mass (Da):75,016
Last modified:October 14, 2008 - v2
Checksum:iA37E9E3D232043AD
GO
Isoform 2 (identifier: Q9H2B4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     193-224: VLMGVLRLGFVSAYLSQPLLDGFAMGASVTIL → TSWGRNSFQQHPWQLTQRSDSQELLEEEERSC
     225-701: Missing.

Note: No experimental confirmation available.
Show »
Length:224
Mass (Da):24,962
Checksum:iC7E7FE5F7ED0E946
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti459 – 4602DL → GF in AAG22075 (PubMed:11087667).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti556 – 5561Q → R.2 Publications
Corresponds to variant rs3796622 [ dbSNP | Ensembl ].
VAR_046727

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei193 – 22432VLMGV…SVTIL → TSWGRNSFQQHPWQLTQRSD SQELLEEEERSC in isoform 2. 1 PublicationVSP_043671Add
BLAST
Alternative sequencei225 – 701477Missing in isoform 2. 1 PublicationVSP_043672Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF297659 mRNA. Translation: AAG22075.1.
AY124771 mRNA. Translation: AAM94171.1.
AK292747 mRNA. Translation: BAF85436.1.
AC019103 Genomic DNA. No translation available.
CH471131 Genomic DNA. Translation: EAW82628.1.
CH471131 Genomic DNA. Translation: EAW82629.1.
BC015517 mRNA. Translation: AAH15517.1.
CCDSiCCDS33933.1. [Q9H2B4-2]
CCDS33934.1. [Q9H2B4-1]
RefSeqiNP_071325.2. NM_022042.3. [Q9H2B4-1]
NP_602297.1. NM_134425.2. [Q9H2B4-2]
NP_998778.1. NM_213613.3. [Q9H2B4-1]
UniGeneiHs.658244.

Genome annotation databases

EnsembliENST00000361661; ENSP00000354721; ENSG00000145217. [Q9H2B4-1]
ENST00000398516; ENSP00000381528; ENSG00000145217. [Q9H2B4-1]
ENST00000398520; ENSP00000381532; ENSG00000145217. [Q9H2B4-2]
ENST00000622731; ENSP00000483506; ENSG00000145217. [Q9H2B4-2]
GeneIDi10861.
KEGGihsa:10861.
UCSCiuc003gbx.5. human. [Q9H2B4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF297659 mRNA. Translation: AAG22075.1.
AY124771 mRNA. Translation: AAM94171.1.
AK292747 mRNA. Translation: BAF85436.1.
AC019103 Genomic DNA. No translation available.
CH471131 Genomic DNA. Translation: EAW82628.1.
CH471131 Genomic DNA. Translation: EAW82629.1.
BC015517 mRNA. Translation: AAH15517.1.
CCDSiCCDS33933.1. [Q9H2B4-2]
CCDS33934.1. [Q9H2B4-1]
RefSeqiNP_071325.2. NM_022042.3. [Q9H2B4-1]
NP_602297.1. NM_134425.2. [Q9H2B4-2]
NP_998778.1. NM_213613.3. [Q9H2B4-1]
UniGeneiHs.658244.

3D structure databases

ProteinModelPortaliQ9H2B4.
SMRiQ9H2B4. Positions 508-690.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116071. 1 interaction.
STRINGi9606.ENSP00000354721.

Protein family/group databases

TCDBi2.A.53.2.16. the sulfate permease (sulp) family.

PTM databases

iPTMnetiQ9H2B4.
PhosphoSiteiQ9H2B4.

Polymorphism and mutation databases

DMDMi209572674.

Proteomic databases

MaxQBiQ9H2B4.
PaxDbiQ9H2B4.
PeptideAtlasiQ9H2B4.
PRIDEiQ9H2B4.

Protocols and materials databases

DNASUi10861.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000361661; ENSP00000354721; ENSG00000145217. [Q9H2B4-1]
ENST00000398516; ENSP00000381528; ENSG00000145217. [Q9H2B4-1]
ENST00000398520; ENSP00000381532; ENSG00000145217. [Q9H2B4-2]
ENST00000622731; ENSP00000483506; ENSG00000145217. [Q9H2B4-2]
GeneIDi10861.
KEGGihsa:10861.
UCSCiuc003gbx.5. human. [Q9H2B4-1]

Organism-specific databases

CTDi10861.
GeneCardsiSLC26A1.
HGNCiHGNC:10993. SLC26A1.
HPAiHPA041654.
MIMi610130. gene.
neXtProtiNX_Q9H2B4.
PharmGKBiPA400.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0236. Eukaryota.
COG0659. LUCA.
GeneTreeiENSGT00760000119026.
HOGENOMiHOG000006546.
HOVERGENiHBG000639.
InParanoidiQ9H2B4.
KOiK14700.
OMAiLPAFLHC.
OrthoDBiEOG091G07RT.
PhylomeDBiQ9H2B4.
TreeFamiTF313784.

Enzyme and pathway databases

ReactomeiR-HSA-174362. Transport and synthesis of PAPS.
R-HSA-427601. Multifunctional anion exchangers.

Miscellaneous databases

ChiTaRSiSLC26A1. human.
GenomeRNAii10861.
PROiQ9H2B4.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000145217.
CleanExiHS_SAT1.
HS_SLC26A1.
GenevisibleiQ9H2B4. HS.

Family and domain databases

Gene3Di3.30.750.24. 2 hits.
InterProiIPR018045. S04_transporter_CS.
IPR011547. SLC26A/SulP_dom.
IPR001902. SLC26A/SulP_fam.
IPR030331. SLC26A1.
IPR002645. STAS_dom.
[Graphical view]
PANTHERiPTHR11814. PTHR11814. 2 hits.
PTHR11814:SF31. PTHR11814:SF31. 2 hits.
PfamiPF01740. STAS. 1 hit.
PF00916. Sulfate_transp. 1 hit.
[Graphical view]
SUPFAMiSSF52091. SSF52091. 2 hits.
TIGRFAMsiTIGR00815. sulP. 1 hit.
PROSITEiPS01130. SLC26A. 1 hit.
PS50801. STAS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiS26A1_HUMAN
AccessioniPrimary (citable) accession number: Q9H2B4
Secondary accession number(s): A8K9N2, Q7Z5R3, Q96BK0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 5, 2002
Last sequence update: October 14, 2008
Last modified: September 7, 2016
This is version 131 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.