Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9H254

- SPTN4_HUMAN

UniProt

Q9H254 - SPTN4_HUMAN

Protein

Spectrin beta chain, non-erythrocytic 4

Gene

SPTBN4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 130 (01 Oct 2014)
      Sequence version 2 (16 Nov 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. actin binding Source: UniProtKB
    2. ankyrin binding Source: UniProtKB
    3. phosphatase binding Source: BHF-UCL
    4. phospholipid binding Source: InterPro
    5. protein binding Source: IntAct
    6. spectrin binding Source: BHF-UCL
    7. structural constituent of cytoskeleton Source: UniProtKB

    GO - Biological processi

    1. actin filament capping Source: UniProtKB-KW
    2. adult walking behavior Source: BHF-UCL
    3. axon guidance Source: Reactome
    4. axonogenesis Source: BHF-UCL
    5. cardiac conduction Source: BHF-UCL
    6. central nervous system projection neuron axonogenesis Source: BHF-UCL
    7. clustering of voltage-gated sodium channels Source: BHF-UCL
    8. cytoskeletal anchoring at plasma membrane Source: UniProtKB
    9. establishment of protein localization to plasma membrane Source: BHF-UCL
    10. fertilization Source: Ensembl
    11. negative regulation of heart rate Source: BHF-UCL
    12. positive regulation of multicellular organism growth Source: Ensembl
    13. regulation of peptidyl-serine phosphorylation Source: BHF-UCL
    14. regulation of sodium ion transport Source: BHF-UCL
    15. sensory perception of sound Source: BHF-UCL
    16. transmission of nerve impulse Source: BHF-UCL
    17. vesicle-mediated transport Source: UniProtKB

    Keywords - Molecular functioni

    Actin capping

    Keywords - Ligandi

    Actin-binding

    Enzyme and pathway databases

    ReactomeiREACT_18334. NCAM signaling for neurite out-growth.
    REACT_22266. Interaction between L1 and Ankyrins.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Spectrin beta chain, non-erythrocytic 4
    Alternative name(s):
    Beta-IV spectrin
    Spectrin, non-erythroid beta chain 3
    Gene namesi
    Name:SPTBN4
    Synonyms:KIAA1642, SPTBN3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:14896. SPTBN4.

    Subcellular locationi

    Cytoplasmcytoskeleton By similarity. Cytoplasmcell cortex By similarity

    GO - Cellular componenti

    1. adherens junction Source: BHF-UCL
    2. axon hillock Source: BHF-UCL
    3. axon initial segment Source: BHF-UCL
    4. cell body fiber Source: BHF-UCL
    5. cytoplasm Source: UniProtKB
    6. cytosol Source: Reactome
    7. membrane Source: BHF-UCL
    8. neuronal cell body Source: BHF-UCL
    9. node of Ranvier Source: BHF-UCL
    10. nuclear matrix Source: UniProtKB
    11. paranode region of axon Source: Ensembl
    12. plasma membrane Source: BHF-UCL
    13. PML body Source: UniProtKB
    14. spectrin Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Cytoskeleton

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA37918.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 25642564Spectrin beta chain, non-erythrocytic 4PRO_0000073465Add
    BLAST

    Proteomic databases

    MaxQBiQ9H254.
    PaxDbiQ9H254.
    PRIDEiQ9H254.

    PTM databases

    PhosphoSiteiQ9H254.

    Expressioni

    Tissue specificityi

    Abundantly expressed in brain and pancreatic islets.

    Gene expression databases

    ArrayExpressiQ9H254.
    BgeeiQ9H254.
    CleanExiHS_SPTBN4.
    GenevestigatoriQ9H254.

    Organism-specific databases

    HPAiHPA043370.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    DISC1Q9NRI53EBI-308543,EBI-529989
    PTPRNQ168492EBI-308543,EBI-728153

    Protein-protein interaction databases

    BioGridi121751. 13 interactions.
    IntActiQ9H254. 12 interactions.
    MINTiMINT-8247405.
    STRINGi9606.ENSP00000263373.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9H254.
    SMRiQ9H254. Positions 55-287, 309-2114, 2422-2525.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini1 – 282282Actin-bindingAdd
    BLAST
    Domaini61 – 165105CH 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini180 – 282103CH 2PROSITE-ProRule annotationAdd
    BLAST
    Repeati309 – 35446Spectrin 1Add
    BLAST
    Repeati398 – 41922Spectrin 2Add
    BLAST
    Repeati429 – 533105Spectrin 3Add
    BLAST
    Repeati535 – 642108Spectrin 4Add
    BLAST
    Repeati644 – 771128Spectrin 5Add
    BLAST
    Repeati773 – 879107Spectrin 6Add
    BLAST
    Repeati881 – 985105Spectrin 7Add
    BLAST
    Repeati1019 – 108668Spectrin 8Add
    BLAST
    Repeati1088 – 1197110Spectrin 9Add
    BLAST
    Repeati1199 – 1303105Spectrin 10Add
    BLAST
    Repeati1305 – 1408104Spectrin 11Add
    BLAST
    Repeati1410 – 1513104Spectrin 12Add
    BLAST
    Repeati1515 – 1619105Spectrin 13Add
    BLAST
    Repeati1621 – 1725105Spectrin 14Add
    BLAST
    Repeati1727 – 1832106Spectrin 15Add
    BLAST
    Repeati1834 – 1940107Spectrin 16Add
    BLAST
    Repeati1942 – 2046105Spectrin 17Add
    BLAST
    Repeati2048 – 210760Spectrin 18Add
    BLAST
    Domaini2418 – 2527110PHPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the spectrin family.Curated
    Contains 2 CH (calponin-homology) domains.PROSITE-ProRule annotation
    Contains 1 PH domain.PROSITE-ProRule annotation
    Contains 18 spectrin repeats.Curated

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiCOG5069.
    HOGENOMiHOG000007281.
    HOVERGENiHBG057912.
    InParanoidiQ9H254.
    KOiK06115.
    OMAiRKEEMSA.
    PhylomeDBiQ9H254.
    TreeFamiTF313446.

    Family and domain databases

    Gene3Di1.10.418.10. 2 hits.
    2.30.29.30. 1 hit.
    InterProiIPR001589. Actinin_actin-bd_CS.
    IPR001715. CH-domain.
    IPR001605. PH_dom-spectrin-type.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR018159. Spectrin/alpha-actinin.
    IPR016343. Spectrin_bsu.
    IPR002017. Spectrin_repeat.
    [Graphical view]
    PfamiPF00307. CH. 2 hits.
    PF00435. Spectrin. 14 hits.
    [Graphical view]
    PIRSFiPIRSF002297. Spectrin_beta_subunit. 1 hit.
    PRINTSiPR00683. SPECTRINPH.
    SMARTiSM00033. CH. 2 hits.
    SM00233. PH. 1 hit.
    SM00150. SPEC. 16 hits.
    [Graphical view]
    SUPFAMiSSF47576. SSF47576. 1 hit.
    PROSITEiPS00019. ACTININ_1. 1 hit.
    PS00020. ACTININ_2. 1 hit.
    PS50021. CH. 2 hits.
    PS50003. PH_DOMAIN. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9H254-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAQVPGEVDN MEGLPAPNNN PAARWESPDR GWEREQPAAS TAAASLFECS     50
    RIKALADERE AVQKKTFTKW VNSHLARVGC HIGDLYVDLR DGFVLTRLLE 100
    VLSGEQLPRP TRGRMRIHSL ENVDKALQFL KEQRVHLENV GSHDIVDGNH 150
    RLTLGLVWTI ILRFQIQVIK IETEDNRETR SAKDALLLWC QMKTAGYPEV 200
    NIQNFTTSWR DGLAFNALIH RHRPDLVDFS KLTKSNANYN LQRAFRTAEQ 250
    HLGLARLLDP EDVNMEAPDE KSIITYVVSF YHYFSKMKAL AVEGKRIGKV 300
    LDQVLEVGKI IERYEELAAE LLAWIHRTVG LISNQKFANS LSGVQQQLQA 350
    FTAYCTLEKP VKFQEKGNLE VLLFSIQSKL RACNRRLFVP REGCGIWDID 400
    KAWGELEKAE HEREAALRAE LIRQEKLELL AQRFDHKVAM RESWLNENQR 450
    LVSQDNFGYE LPAVEAAMKK HEAIEADIAA YEERVQGVAE LAQALAAEGY 500
    YDIRRVAAQR DSVLRQWALL TGLVGARRTR LEQNLALQKV FQEMVYMVDW 550
    MEEMQAQLLS RECGQHLVEA DDLLQKHGLL EGDIAAQSER VEALNAAALR 600
    FSQLQGYQPC DPQVICNRVN HVHGCLAELQ EQAARRRAEL EASRSLWALL 650
    QELEEAESWA RDKERLLEAA GGGGAAGAAG AAGTAGGAHD LSSTARLLAQ 700
    HKILQGELGG RRALLQQALR CGEELVAAGG AVGPGADTVH LVGLAERAAS 750
    ARRRWQRLEE AAARRERRLQ EARALHQFGA DLDGLLDWLR DAYRLAAAGD 800
    FGHDEASSRR LARQHRALTG EVEAHRGPVS GLRRQLATLG GASGAGPLVV 850
    ALQVRVVEAE QLFAEVTEVA ALRRQWLRDA LAVYRMFGEV HACELWIGEK 900
    EQWLLSMRVP DSLDDVEVVQ HRFESLDQEM NSLMGRVLDV NHTVQELVEG 950
    GHPSSDEVRS CQDHLNSRWN RIVELVEQRK EEMSAVLLVE NHVLEVAEVR 1000
    AQVREKRRAV ESAPRAGGAL QWRLSGLEAA LQALEPRQAA LLEEAALLAE 1050
    RFPAQAARLH QGAEELGAEW GALASAAQAC GEAVAAAGRL QRFLHDLDAF 1100
    LDWLVRAQEA AGGSEGPLPN SLEEADALLA RHAALKEEVD QREEDYARIV 1150
    AASEALLAAD GAELGPGLAL DEWLPHLELG WHKLLGLWEA RREALVQAHI 1200
    YQLFLRDLRQ ALVVLRNQEM ALSGAELPGT VESVEEALKQ HRDFLTTMEL 1250
    SQQKMQVAVQ AAEGLLRQGN IYGEQAQEAV TRLLEKNQEN QLRAQQWMQK 1300
    LHDQLELQHF LRDCHELDGW IHEKMLMARD GTREDNHKLH KRWLRHQAFM 1350
    AELAQNKEWL EKIEREGQQL MQEKPELAAS VRKKLGEIRQ CWAELESTTQ 1400
    AKARQLFEAS KADQLVQSFA ELDKKLLHME SQLQDVDPGG DLATVNSQLK 1450
    KLQSMESQVE EWYREVGELQ AQTAALPLEP ASKELVGERQ NAVGERLVRL 1500
    LEPLQERRRL LLASKELHQV AHDLDDELAW VQERLPLAMQ TERGNGLQAV 1550
    QQHIKKNQGL RREIQAHGPR LEEVLERAGA LASLRSPEAE AVRRGLEQLQ 1600
    SAWAGLREAA ERRQQVLDAA FQVEQYYFDV AEVEAWLGEQ ELLMMSEDKG 1650
    KDEQSTLQLL KKHLQLEQGV ENYEESIAQL SRQCRALLEM GHPDSEQISR 1700
    RQSQVDRLYV ALKELGEERR VALEQQYWLY QLSRQVSELE HWIAEKEVVA 1750
    GSPELGQDFE HVSVLQEKFS EFASETGMAG RERLAAVNQM VDELIECGHT 1800
    AAATMAEWKD GLNEAWAELL ELMGTRAQLL AASRELHKFF SDARELQGQI 1850
    EEKRRRLPRL TTPPEPRPSA SSMQRTLRAF EHDLQLLVSQ VRQLQEGAAQ 1900
    LRTVYAGEHA EAIASREQEV LQGWKELLSA CEDARLHVSS TADALRFHSQ 1950
    VRDLLSWMDG IASQIGAADK PRDVSSVEVL MNYHQGLKTE LEARVPELTT 2000
    CQELGRSLLL NKSAMADEIQ AQLDKLGTRK EEVSEKWDRH WEWLQQMLEV 2050
    HQFAQEAVVA DAWLTAQEPL LQSRELGSSV DEVEQLIRRH EAFRKAAAAW 2100
    EERFSSLRRL TTIEKIKAEQ SKQPPTPLLG RKFFGDPTEL AAKAAPLLRP 2150
    GGYERGLEPL ARRASDTLSA EVRTRVGYVR QELKPERLQP RIDRLPEIPG 2200
    RVEPAALPAA PEDAAETPAT PAAAEQVRPR PERQESADRA EELPRRRRPE 2250
    RQESVDQSEE AARRRRPERQ ESAEHEAAHS LTLGRYEQME RRRERRERRL 2300
    ERQESSEQEM PIRGDLVKGK ATLADIVEQL QEKEAGPGLP AGPSLPQPRE 2350
    LPPGRLPNGL ELPERTPRPD RPRARDRPKP RRRPRPREGG EGGGSRRSRS 2400
    APAQGGSAPA PPPPPTHTVQ HEGFLLRKRE LDANRKSSNR SWVSLYCVLS 2450
    KGELGFYKDS KGPASGSTHG GEPLLSLHKA TSEVASDYKK KKHVFKLQTQ 2500
    DGSEFLLQAK DEEEMNGWLE AVASSVAEHA EIARWGQTLP TTSSTDEGNP 2550
    KREGGDRRAS GRRK 2564
    Length:2,564
    Mass (Da):288,985
    Last modified:November 16, 2001 - v2
    Checksum:i52CDE7D11D601ECC
    GO
    Isoform 2 (identifier: Q9H254-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1287-1309: NQENQLRAQQWMQKLHDQLELQH → CLIIHPALLHPPWEPPYLPRSSS
         1310-2564: Missing.

    Show »
    Length:1,309
    Mass (Da):146,169
    Checksum:i7EC61D92DAC5479C
    GO
    Isoform 3 (identifier: Q9H254-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1257: Missing.
         1258-1286: AVQAAEGLLRQGNIYGEQAQEAVTRLLEK → MPHYPSCSSAPSLGTPIPPQIQQLEARHR

    Show »
    Length:1,307
    Mass (Da):148,622
    Checksum:i1CE0DB8C9686B90E
    GO
    Isoform 4 (identifier: Q9H254-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         2113-2154: IEKIKAEQSK...APLLRPGGYE → PRREDHLNPG...KTARRDGTCL
         2155-2564: Missing.

    Show »
    Length:2,154
    Mass (Da):243,424
    Checksum:iB36417A996D80609
    GO
    Isoform 5 (identifier: Q9H254-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1324: Missing.
         1973-2002: DVSSVEVLMNYHQGLKTELEARVPELTTCQ → CPSSLLGLPASPWWPTPATPSPLTAPFSME
         2003-2564: Missing.

    Show »
    Length:678
    Mass (Da):77,167
    Checksum:i53C7058D7A66F4B9
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti604 – 6085Missing in AAG38874. (PubMed:11086001)Curated
    Sequence conflicti604 – 6085Missing in AAF93171. (PubMed:11086001)Curated
    Sequence conflicti714 – 7141L → S in AAG38874. (PubMed:11086001)Curated
    Sequence conflicti714 – 7141L → S in AAF93171. (PubMed:11086001)Curated
    Sequence conflicti714 – 7141L → S in AAF93173. (PubMed:11086001)Curated
    Sequence conflicti1189 – 11891E → K in AAG38874. (PubMed:11086001)Curated
    Sequence conflicti1189 – 11891E → K in AAF93171. (PubMed:11086001)Curated
    Sequence conflicti1189 – 11891E → K in AAF93173. (PubMed:11086001)Curated
    Sequence conflicti1193 – 11931E → K in AAG38874. (PubMed:11086001)Curated
    Sequence conflicti1193 – 11931E → K in AAF93171. (PubMed:11086001)Curated
    Sequence conflicti1193 – 11931E → K in AAF93173. (PubMed:11086001)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti1331 – 13311G → S.1 Publication
    Corresponds to variant rs814501 [ dbSNP | Ensembl ].
    VAR_048632

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 13241324Missing in isoform 5. 1 PublicationVSP_046383Add
    BLAST
    Alternative sequencei1 – 12571257Missing in isoform 3. 1 PublicationVSP_000723Add
    BLAST
    Alternative sequencei1258 – 128629AVQAA…RLLEK → MPHYPSCSSAPSLGTPIPPQ IQQLEARHR in isoform 3. 1 PublicationVSP_000724Add
    BLAST
    Alternative sequencei1287 – 130923NQENQ…LELQH → CLIIHPALLHPPWEPPYLPR SSS in isoform 2. 1 PublicationVSP_000725Add
    BLAST
    Alternative sequencei1310 – 25641255Missing in isoform 2. 1 PublicationVSP_000726Add
    BLAST
    Alternative sequencei1973 – 200230DVSSV…LTTCQ → CPSSLLGLPASPWWPTPATP SPLTAPFSME in isoform 5. 1 PublicationVSP_046384Add
    BLAST
    Alternative sequencei2003 – 2564562Missing in isoform 5. 1 PublicationVSP_046385Add
    BLAST
    Alternative sequencei2113 – 215442IEKIK…PGGYE → PRREDHLNPGVQDQPWQHTE KPSLPKPKANKEKTARRDGT CL in isoform 4. 1 PublicationVSP_000727Add
    BLAST
    Alternative sequencei2155 – 2564410Missing in isoform 4. 1 PublicationVSP_000728Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF311855 mRNA. Translation: AAG42473.1.
    AF311856 mRNA. Translation: AAG42474.1.
    AF082075 mRNA. Translation: AAG38874.1.
    AY004226 mRNA. Translation: AAF93171.1.
    AY004226 mRNA. Translation: AAF93172.1.
    AY004227 mRNA. Translation: AAF93173.1.
    AC020929 Genomic DNA. No translation available.
    AB046862 mRNA. Translation: BAB13468.1.
    CCDSiCCDS12559.1. [Q9H254-1]
    CCDS42569.1. [Q9H254-5]
    RefSeqiNP_066022.2. NM_020971.2. [Q9H254-1]
    NP_079489.2. NM_025213.2. [Q9H254-5]
    UniGeneiHs.32706.

    Genome annotation databases

    EnsembliENST00000338932; ENSP00000340345; ENSG00000160460. [Q9H254-4]
    ENST00000352632; ENSP00000263373; ENSG00000160460. [Q9H254-1]
    ENST00000392023; ENSP00000375877; ENSG00000160460. [Q9H254-5]
    ENST00000598249; ENSP00000469242; ENSG00000160460. [Q9H254-1]
    GeneIDi57731.
    KEGGihsa:57731.
    UCSCiuc002onx.3. human. [Q9H254-1]

    Polymorphism databases

    DMDMi17368942.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF311855 mRNA. Translation: AAG42473.1 .
    AF311856 mRNA. Translation: AAG42474.1 .
    AF082075 mRNA. Translation: AAG38874.1 .
    AY004226 mRNA. Translation: AAF93171.1 .
    AY004226 mRNA. Translation: AAF93172.1 .
    AY004227 mRNA. Translation: AAF93173.1 .
    AC020929 Genomic DNA. No translation available.
    AB046862 mRNA. Translation: BAB13468.1 .
    CCDSi CCDS12559.1. [Q9H254-1 ]
    CCDS42569.1. [Q9H254-5 ]
    RefSeqi NP_066022.2. NM_020971.2. [Q9H254-1 ]
    NP_079489.2. NM_025213.2. [Q9H254-5 ]
    UniGenei Hs.32706.

    3D structure databases

    ProteinModelPortali Q9H254.
    SMRi Q9H254. Positions 55-287, 309-2114, 2422-2525.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 121751. 13 interactions.
    IntActi Q9H254. 12 interactions.
    MINTi MINT-8247405.
    STRINGi 9606.ENSP00000263373.

    PTM databases

    PhosphoSitei Q9H254.

    Polymorphism databases

    DMDMi 17368942.

    Proteomic databases

    MaxQBi Q9H254.
    PaxDbi Q9H254.
    PRIDEi Q9H254.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000338932 ; ENSP00000340345 ; ENSG00000160460 . [Q9H254-4 ]
    ENST00000352632 ; ENSP00000263373 ; ENSG00000160460 . [Q9H254-1 ]
    ENST00000392023 ; ENSP00000375877 ; ENSG00000160460 . [Q9H254-5 ]
    ENST00000598249 ; ENSP00000469242 ; ENSG00000160460 . [Q9H254-1 ]
    GeneIDi 57731.
    KEGGi hsa:57731.
    UCSCi uc002onx.3. human. [Q9H254-1 ]

    Organism-specific databases

    CTDi 57731.
    GeneCardsi GC19P040973.
    H-InvDB HIX0015138.
    HGNCi HGNC:14896. SPTBN4.
    HPAi HPA043370.
    MIMi 606214. gene.
    neXtProti NX_Q9H254.
    PharmGKBi PA37918.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5069.
    HOGENOMi HOG000007281.
    HOVERGENi HBG057912.
    InParanoidi Q9H254.
    KOi K06115.
    OMAi RKEEMSA.
    PhylomeDBi Q9H254.
    TreeFami TF313446.

    Enzyme and pathway databases

    Reactomei REACT_18334. NCAM signaling for neurite out-growth.
    REACT_22266. Interaction between L1 and Ankyrins.

    Miscellaneous databases

    GeneWikii SPTBN4.
    GenomeRNAii 57731.
    NextBioi 64688.
    PROi Q9H254.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9H254.
    Bgeei Q9H254.
    CleanExi HS_SPTBN4.
    Genevestigatori Q9H254.

    Family and domain databases

    Gene3Di 1.10.418.10. 2 hits.
    2.30.29.30. 1 hit.
    InterProi IPR001589. Actinin_actin-bd_CS.
    IPR001715. CH-domain.
    IPR001605. PH_dom-spectrin-type.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR018159. Spectrin/alpha-actinin.
    IPR016343. Spectrin_bsu.
    IPR002017. Spectrin_repeat.
    [Graphical view ]
    Pfami PF00307. CH. 2 hits.
    PF00435. Spectrin. 14 hits.
    [Graphical view ]
    PIRSFi PIRSF002297. Spectrin_beta_subunit. 1 hit.
    PRINTSi PR00683. SPECTRINPH.
    SMARTi SM00033. CH. 2 hits.
    SM00233. PH. 1 hit.
    SM00150. SPEC. 16 hits.
    [Graphical view ]
    SUPFAMi SSF47576. SSF47576. 1 hit.
    PROSITEi PS00019. ACTININ_1. 1 hit.
    PS00020. ACTININ_2. 1 hit.
    PS50021. CH. 2 hits.
    PS50003. PH_DOMAIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A new spectrin, beta-IV, has a major truncated isoform that associates with promyelocytic leukemia protein nuclear bodies and the nuclear matrix."
      Tse W.T., Tang J., Jin O., Korsgren C., John K.M., Kung A.L., Gwynn B., Peters L.L., Lux S.E.
      J. Biol. Chem. 276:23974-23985(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 5), VARIANT SER-1331.
    2. "BetaIV spectrin, a new spectrin localized at axon initial segments and nodes of Ranvier in the central and peripheral nervous system."
      Berghs S., Aggujaro D., Dirkx R. Jr., Maksimova E., Stabach P., Hermel J.-M., Zhang J.-P., Philbrick W., Slepnev V., Ort T., Solimena M.
      J. Cell Biol. 151:985-1002(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4).
    3. "The DNA sequence and biology of human chromosome 19."
      Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
      , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
      Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
      DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 386-2382 (ISOFORM 1).
      Tissue: Brain.

    Entry informationi

    Entry nameiSPTN4_HUMAN
    AccessioniPrimary (citable) accession number: Q9H254
    Secondary accession number(s): E9PGQ5
    , Q9H1K7, Q9H1K8, Q9H1K9, Q9H253, Q9H3G8, Q9HCD0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 16, 2001
    Last sequence update: November 16, 2001
    Last modified: October 1, 2014
    This is version 130 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3