SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9H254

- SPTN4_HUMAN

UniProt

Q9H254 - SPTN4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Spectrin beta chain, non-erythrocytic 4

Gene
SPTBN4, KIAA1642, SPTBN3
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  1. actin binding Source: UniProtKB
  2. ankyrin binding Source: UniProtKB
  3. phosphatase binding Source: BHF-UCL
  4. phospholipid binding Source: InterPro
  5. protein binding Source: IntAct
  6. spectrin binding Source: BHF-UCL
  7. structural constituent of cytoskeleton Source: UniProtKB

GO - Biological processi

  1. actin filament capping Source: UniProtKB-KW
  2. adult walking behavior Source: BHF-UCL
  3. axon guidance Source: Reactome
  4. axonogenesis Source: BHF-UCL
  5. cardiac conduction Source: BHF-UCL
  6. central nervous system projection neuron axonogenesis Source: BHF-UCL
  7. clustering of voltage-gated sodium channels Source: BHF-UCL
  8. cytoskeletal anchoring at plasma membrane Source: UniProtKB
  9. establishment of protein localization to plasma membrane Source: BHF-UCL
  10. fertilization Source: Ensembl
  11. negative regulation of heart rate Source: BHF-UCL
  12. positive regulation of multicellular organism growth Source: Ensembl
  13. regulation of peptidyl-serine phosphorylation Source: BHF-UCL
  14. regulation of sodium ion transport Source: BHF-UCL
  15. sensory perception of sound Source: BHF-UCL
  16. transmission of nerve impulse Source: BHF-UCL
  17. vesicle-mediated transport Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Actin capping

Keywords - Ligandi

Actin-binding

Enzyme and pathway databases

ReactomeiREACT_18334. NCAM signaling for neurite out-growth.
REACT_22266. Interaction between L1 and Ankyrins.

Names & Taxonomyi

Protein namesi
Recommended name:
Spectrin beta chain, non-erythrocytic 4
Alternative name(s):
Beta-IV spectrin
Spectrin, non-erythroid beta chain 3
Gene namesi
Name:SPTBN4
Synonyms:KIAA1642, SPTBN3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:14896. SPTBN4.

Subcellular locationi

Cytoplasmcytoskeleton By similarity. Cytoplasmcell cortex By similarity

GO - Cellular componenti

  1. adherens junction Source: BHF-UCL
  2. axon hillock Source: BHF-UCL
  3. axon initial segment Source: BHF-UCL
  4. cell body fiber Source: BHF-UCL
  5. cytoplasm Source: UniProtKB
  6. cytosol Source: Reactome
  7. membrane Source: BHF-UCL
  8. neuronal cell body Source: BHF-UCL
  9. node of Ranvier Source: BHF-UCL
  10. nuclear matrix Source: UniProtKB
  11. paranode region of axon Source: Ensembl
  12. plasma membrane Source: BHF-UCL
  13. PML body Source: UniProtKB
  14. spectrin Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA37918.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 25642564Spectrin beta chain, non-erythrocytic 4PRO_0000073465Add
BLAST

Proteomic databases

MaxQBiQ9H254.
PaxDbiQ9H254.
PRIDEiQ9H254.

PTM databases

PhosphoSiteiQ9H254.

Expressioni

Tissue specificityi

Abundantly expressed in brain and pancreatic islets.

Gene expression databases

ArrayExpressiQ9H254.
BgeeiQ9H254.
CleanExiHS_SPTBN4.
GenevestigatoriQ9H254.

Organism-specific databases

HPAiHPA043370.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
DISC1Q9NRI53EBI-308543,EBI-529989
PTPRNQ168492EBI-308543,EBI-728153

Protein-protein interaction databases

BioGridi121751. 13 interactions.
IntActiQ9H254. 12 interactions.
MINTiMINT-8247405.
STRINGi9606.ENSP00000263373.

Structurei

3D structure databases

ProteinModelPortaliQ9H254.
SMRiQ9H254. Positions 55-287, 309-2114, 2422-2525.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 282282Actin-bindingAdd
BLAST
Domaini61 – 165105CH 1Add
BLAST
Domaini180 – 282103CH 2Add
BLAST
Repeati309 – 35446Spectrin 1Add
BLAST
Repeati398 – 41922Spectrin 2Add
BLAST
Repeati429 – 533105Spectrin 3Add
BLAST
Repeati535 – 642108Spectrin 4Add
BLAST
Repeati644 – 771128Spectrin 5Add
BLAST
Repeati773 – 879107Spectrin 6Add
BLAST
Repeati881 – 985105Spectrin 7Add
BLAST
Repeati1019 – 108668Spectrin 8Add
BLAST
Repeati1088 – 1197110Spectrin 9Add
BLAST
Repeati1199 – 1303105Spectrin 10Add
BLAST
Repeati1305 – 1408104Spectrin 11Add
BLAST
Repeati1410 – 1513104Spectrin 12Add
BLAST
Repeati1515 – 1619105Spectrin 13Add
BLAST
Repeati1621 – 1725105Spectrin 14Add
BLAST
Repeati1727 – 1832106Spectrin 15Add
BLAST
Repeati1834 – 1940107Spectrin 16Add
BLAST
Repeati1942 – 2046105Spectrin 17Add
BLAST
Repeati2048 – 210760Spectrin 18Add
BLAST
Domaini2418 – 2527110PHAdd
BLAST

Sequence similaritiesi

Belongs to the spectrin family.
Contains 1 PH domain.
Contains 18 spectrin repeats.

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiCOG5069.
HOGENOMiHOG000007281.
HOVERGENiHBG057912.
InParanoidiQ9H254.
KOiK06115.
OMAiRKEEMSA.
PhylomeDBiQ9H254.
TreeFamiTF313446.

Family and domain databases

Gene3Di1.10.418.10. 2 hits.
2.30.29.30. 1 hit.
InterProiIPR001589. Actinin_actin-bd_CS.
IPR001715. CH-domain.
IPR001605. PH_dom-spectrin-type.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR018159. Spectrin/alpha-actinin.
IPR016343. Spectrin_bsu.
IPR002017. Spectrin_repeat.
[Graphical view]
PfamiPF00307. CH. 2 hits.
PF00435. Spectrin. 14 hits.
[Graphical view]
PIRSFiPIRSF002297. Spectrin_beta_subunit. 1 hit.
PRINTSiPR00683. SPECTRINPH.
SMARTiSM00033. CH. 2 hits.
SM00233. PH. 1 hit.
SM00150. SPEC. 16 hits.
[Graphical view]
SUPFAMiSSF47576. SSF47576. 1 hit.
PROSITEiPS00019. ACTININ_1. 1 hit.
PS00020. ACTININ_2. 1 hit.
PS50021. CH. 2 hits.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9H254-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAQVPGEVDN MEGLPAPNNN PAARWESPDR GWEREQPAAS TAAASLFECS     50
RIKALADERE AVQKKTFTKW VNSHLARVGC HIGDLYVDLR DGFVLTRLLE 100
VLSGEQLPRP TRGRMRIHSL ENVDKALQFL KEQRVHLENV GSHDIVDGNH 150
RLTLGLVWTI ILRFQIQVIK IETEDNRETR SAKDALLLWC QMKTAGYPEV 200
NIQNFTTSWR DGLAFNALIH RHRPDLVDFS KLTKSNANYN LQRAFRTAEQ 250
HLGLARLLDP EDVNMEAPDE KSIITYVVSF YHYFSKMKAL AVEGKRIGKV 300
LDQVLEVGKI IERYEELAAE LLAWIHRTVG LISNQKFANS LSGVQQQLQA 350
FTAYCTLEKP VKFQEKGNLE VLLFSIQSKL RACNRRLFVP REGCGIWDID 400
KAWGELEKAE HEREAALRAE LIRQEKLELL AQRFDHKVAM RESWLNENQR 450
LVSQDNFGYE LPAVEAAMKK HEAIEADIAA YEERVQGVAE LAQALAAEGY 500
YDIRRVAAQR DSVLRQWALL TGLVGARRTR LEQNLALQKV FQEMVYMVDW 550
MEEMQAQLLS RECGQHLVEA DDLLQKHGLL EGDIAAQSER VEALNAAALR 600
FSQLQGYQPC DPQVICNRVN HVHGCLAELQ EQAARRRAEL EASRSLWALL 650
QELEEAESWA RDKERLLEAA GGGGAAGAAG AAGTAGGAHD LSSTARLLAQ 700
HKILQGELGG RRALLQQALR CGEELVAAGG AVGPGADTVH LVGLAERAAS 750
ARRRWQRLEE AAARRERRLQ EARALHQFGA DLDGLLDWLR DAYRLAAAGD 800
FGHDEASSRR LARQHRALTG EVEAHRGPVS GLRRQLATLG GASGAGPLVV 850
ALQVRVVEAE QLFAEVTEVA ALRRQWLRDA LAVYRMFGEV HACELWIGEK 900
EQWLLSMRVP DSLDDVEVVQ HRFESLDQEM NSLMGRVLDV NHTVQELVEG 950
GHPSSDEVRS CQDHLNSRWN RIVELVEQRK EEMSAVLLVE NHVLEVAEVR 1000
AQVREKRRAV ESAPRAGGAL QWRLSGLEAA LQALEPRQAA LLEEAALLAE 1050
RFPAQAARLH QGAEELGAEW GALASAAQAC GEAVAAAGRL QRFLHDLDAF 1100
LDWLVRAQEA AGGSEGPLPN SLEEADALLA RHAALKEEVD QREEDYARIV 1150
AASEALLAAD GAELGPGLAL DEWLPHLELG WHKLLGLWEA RREALVQAHI 1200
YQLFLRDLRQ ALVVLRNQEM ALSGAELPGT VESVEEALKQ HRDFLTTMEL 1250
SQQKMQVAVQ AAEGLLRQGN IYGEQAQEAV TRLLEKNQEN QLRAQQWMQK 1300
LHDQLELQHF LRDCHELDGW IHEKMLMARD GTREDNHKLH KRWLRHQAFM 1350
AELAQNKEWL EKIEREGQQL MQEKPELAAS VRKKLGEIRQ CWAELESTTQ 1400
AKARQLFEAS KADQLVQSFA ELDKKLLHME SQLQDVDPGG DLATVNSQLK 1450
KLQSMESQVE EWYREVGELQ AQTAALPLEP ASKELVGERQ NAVGERLVRL 1500
LEPLQERRRL LLASKELHQV AHDLDDELAW VQERLPLAMQ TERGNGLQAV 1550
QQHIKKNQGL RREIQAHGPR LEEVLERAGA LASLRSPEAE AVRRGLEQLQ 1600
SAWAGLREAA ERRQQVLDAA FQVEQYYFDV AEVEAWLGEQ ELLMMSEDKG 1650
KDEQSTLQLL KKHLQLEQGV ENYEESIAQL SRQCRALLEM GHPDSEQISR 1700
RQSQVDRLYV ALKELGEERR VALEQQYWLY QLSRQVSELE HWIAEKEVVA 1750
GSPELGQDFE HVSVLQEKFS EFASETGMAG RERLAAVNQM VDELIECGHT 1800
AAATMAEWKD GLNEAWAELL ELMGTRAQLL AASRELHKFF SDARELQGQI 1850
EEKRRRLPRL TTPPEPRPSA SSMQRTLRAF EHDLQLLVSQ VRQLQEGAAQ 1900
LRTVYAGEHA EAIASREQEV LQGWKELLSA CEDARLHVSS TADALRFHSQ 1950
VRDLLSWMDG IASQIGAADK PRDVSSVEVL MNYHQGLKTE LEARVPELTT 2000
CQELGRSLLL NKSAMADEIQ AQLDKLGTRK EEVSEKWDRH WEWLQQMLEV 2050
HQFAQEAVVA DAWLTAQEPL LQSRELGSSV DEVEQLIRRH EAFRKAAAAW 2100
EERFSSLRRL TTIEKIKAEQ SKQPPTPLLG RKFFGDPTEL AAKAAPLLRP 2150
GGYERGLEPL ARRASDTLSA EVRTRVGYVR QELKPERLQP RIDRLPEIPG 2200
RVEPAALPAA PEDAAETPAT PAAAEQVRPR PERQESADRA EELPRRRRPE 2250
RQESVDQSEE AARRRRPERQ ESAEHEAAHS LTLGRYEQME RRRERRERRL 2300
ERQESSEQEM PIRGDLVKGK ATLADIVEQL QEKEAGPGLP AGPSLPQPRE 2350
LPPGRLPNGL ELPERTPRPD RPRARDRPKP RRRPRPREGG EGGGSRRSRS 2400
APAQGGSAPA PPPPPTHTVQ HEGFLLRKRE LDANRKSSNR SWVSLYCVLS 2450
KGELGFYKDS KGPASGSTHG GEPLLSLHKA TSEVASDYKK KKHVFKLQTQ 2500
DGSEFLLQAK DEEEMNGWLE AVASSVAEHA EIARWGQTLP TTSSTDEGNP 2550
KREGGDRRAS GRRK 2564
Length:2,564
Mass (Da):288,985
Last modified:November 16, 2001 - v2
Checksum:i52CDE7D11D601ECC
GO
Isoform 2 (identifier: Q9H254-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1287-1309: NQENQLRAQQWMQKLHDQLELQH → CLIIHPALLHPPWEPPYLPRSSS
     1310-2564: Missing.

Show »
Length:1,309
Mass (Da):146,169
Checksum:i7EC61D92DAC5479C
GO
Isoform 3 (identifier: Q9H254-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1257: Missing.
     1258-1286: AVQAAEGLLRQGNIYGEQAQEAVTRLLEK → MPHYPSCSSAPSLGTPIPPQIQQLEARHR

Show »
Length:1,307
Mass (Da):148,622
Checksum:i1CE0DB8C9686B90E
GO
Isoform 4 (identifier: Q9H254-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2113-2154: IEKIKAEQSK...APLLRPGGYE → PRREDHLNPG...KTARRDGTCL
     2155-2564: Missing.

Show »
Length:2,154
Mass (Da):243,424
Checksum:iB36417A996D80609
GO
Isoform 5 (identifier: Q9H254-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1324: Missing.
     1973-2002: DVSSVEVLMNYHQGLKTELEARVPELTTCQ → CPSSLLGLPASPWWPTPATPSPLTAPFSME
     2003-2564: Missing.

Show »
Length:678
Mass (Da):77,167
Checksum:i53C7058D7A66F4B9
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti1331 – 13311G → S.1 Publication
Corresponds to variant rs814501 [ dbSNP | Ensembl ].
VAR_048632

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 13241324Missing in isoform 5. VSP_046383Add
BLAST
Alternative sequencei1 – 12571257Missing in isoform 3. VSP_000723Add
BLAST
Alternative sequencei1258 – 128629AVQAA…RLLEK → MPHYPSCSSAPSLGTPIPPQ IQQLEARHR in isoform 3. VSP_000724Add
BLAST
Alternative sequencei1287 – 130923NQENQ…LELQH → CLIIHPALLHPPWEPPYLPR SSS in isoform 2. VSP_000725Add
BLAST
Alternative sequencei1310 – 25641255Missing in isoform 2. VSP_000726Add
BLAST
Alternative sequencei1973 – 200230DVSSV…LTTCQ → CPSSLLGLPASPWWPTPATP SPLTAPFSME in isoform 5. VSP_046384Add
BLAST
Alternative sequencei2003 – 2564562Missing in isoform 5. VSP_046385Add
BLAST
Alternative sequencei2113 – 215442IEKIK…PGGYE → PRREDHLNPGVQDQPWQHTE KPSLPKPKANKEKTARRDGT CL in isoform 4. VSP_000727Add
BLAST
Alternative sequencei2155 – 2564410Missing in isoform 4. VSP_000728Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti604 – 6085Missing in AAG38874. 1 Publication
Sequence conflicti604 – 6085Missing in AAF93171. 1 Publication
Sequence conflicti714 – 7141L → S in AAG38874. 1 Publication
Sequence conflicti714 – 7141L → S in AAF93171. 1 Publication
Sequence conflicti714 – 7141L → S in AAF93173. 1 Publication
Sequence conflicti1189 – 11891E → K in AAG38874. 1 Publication
Sequence conflicti1189 – 11891E → K in AAF93171. 1 Publication
Sequence conflicti1189 – 11891E → K in AAF93173. 1 Publication
Sequence conflicti1193 – 11931E → K in AAG38874. 1 Publication
Sequence conflicti1193 – 11931E → K in AAF93171. 1 Publication
Sequence conflicti1193 – 11931E → K in AAF93173. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF311855 mRNA. Translation: AAG42473.1.
AF311856 mRNA. Translation: AAG42474.1.
AF082075 mRNA. Translation: AAG38874.1.
AY004226 mRNA. Translation: AAF93171.1.
AY004226 mRNA. Translation: AAF93172.1.
AY004227 mRNA. Translation: AAF93173.1.
AC020929 Genomic DNA. No translation available.
AB046862 mRNA. Translation: BAB13468.1.
CCDSiCCDS12559.1. [Q9H254-1]
CCDS42569.1. [Q9H254-5]
RefSeqiNP_066022.2. NM_020971.2. [Q9H254-1]
NP_079489.2. NM_025213.2. [Q9H254-5]
UniGeneiHs.32706.

Genome annotation databases

EnsembliENST00000338932; ENSP00000340345; ENSG00000160460. [Q9H254-4]
ENST00000352632; ENSP00000263373; ENSG00000160460. [Q9H254-1]
ENST00000392023; ENSP00000375877; ENSG00000160460. [Q9H254-5]
ENST00000598249; ENSP00000469242; ENSG00000160460. [Q9H254-1]
GeneIDi57731.
KEGGihsa:57731.
UCSCiuc002onx.3. human. [Q9H254-1]

Polymorphism databases

DMDMi17368942.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF311855 mRNA. Translation: AAG42473.1 .
AF311856 mRNA. Translation: AAG42474.1 .
AF082075 mRNA. Translation: AAG38874.1 .
AY004226 mRNA. Translation: AAF93171.1 .
AY004226 mRNA. Translation: AAF93172.1 .
AY004227 mRNA. Translation: AAF93173.1 .
AC020929 Genomic DNA. No translation available.
AB046862 mRNA. Translation: BAB13468.1 .
CCDSi CCDS12559.1. [Q9H254-1 ]
CCDS42569.1. [Q9H254-5 ]
RefSeqi NP_066022.2. NM_020971.2. [Q9H254-1 ]
NP_079489.2. NM_025213.2. [Q9H254-5 ]
UniGenei Hs.32706.

3D structure databases

ProteinModelPortali Q9H254.
SMRi Q9H254. Positions 55-287, 309-2114, 2422-2525.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 121751. 13 interactions.
IntActi Q9H254. 12 interactions.
MINTi MINT-8247405.
STRINGi 9606.ENSP00000263373.

PTM databases

PhosphoSitei Q9H254.

Polymorphism databases

DMDMi 17368942.

Proteomic databases

MaxQBi Q9H254.
PaxDbi Q9H254.
PRIDEi Q9H254.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000338932 ; ENSP00000340345 ; ENSG00000160460 . [Q9H254-4 ]
ENST00000352632 ; ENSP00000263373 ; ENSG00000160460 . [Q9H254-1 ]
ENST00000392023 ; ENSP00000375877 ; ENSG00000160460 . [Q9H254-5 ]
ENST00000598249 ; ENSP00000469242 ; ENSG00000160460 . [Q9H254-1 ]
GeneIDi 57731.
KEGGi hsa:57731.
UCSCi uc002onx.3. human. [Q9H254-1 ]

Organism-specific databases

CTDi 57731.
GeneCardsi GC19P040973.
H-InvDB HIX0015138.
HGNCi HGNC:14896. SPTBN4.
HPAi HPA043370.
MIMi 606214. gene.
neXtProti NX_Q9H254.
PharmGKBi PA37918.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5069.
HOGENOMi HOG000007281.
HOVERGENi HBG057912.
InParanoidi Q9H254.
KOi K06115.
OMAi RKEEMSA.
PhylomeDBi Q9H254.
TreeFami TF313446.

Enzyme and pathway databases

Reactomei REACT_18334. NCAM signaling for neurite out-growth.
REACT_22266. Interaction between L1 and Ankyrins.

Miscellaneous databases

GeneWikii SPTBN4.
GenomeRNAii 57731.
NextBioi 64688.
PROi Q9H254.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9H254.
Bgeei Q9H254.
CleanExi HS_SPTBN4.
Genevestigatori Q9H254.

Family and domain databases

Gene3Di 1.10.418.10. 2 hits.
2.30.29.30. 1 hit.
InterProi IPR001589. Actinin_actin-bd_CS.
IPR001715. CH-domain.
IPR001605. PH_dom-spectrin-type.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR018159. Spectrin/alpha-actinin.
IPR016343. Spectrin_bsu.
IPR002017. Spectrin_repeat.
[Graphical view ]
Pfami PF00307. CH. 2 hits.
PF00435. Spectrin. 14 hits.
[Graphical view ]
PIRSFi PIRSF002297. Spectrin_beta_subunit. 1 hit.
PRINTSi PR00683. SPECTRINPH.
SMARTi SM00033. CH. 2 hits.
SM00233. PH. 1 hit.
SM00150. SPEC. 16 hits.
[Graphical view ]
SUPFAMi SSF47576. SSF47576. 1 hit.
PROSITEi PS00019. ACTININ_1. 1 hit.
PS00020. ACTININ_2. 1 hit.
PS50021. CH. 2 hits.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A new spectrin, beta-IV, has a major truncated isoform that associates with promyelocytic leukemia protein nuclear bodies and the nuclear matrix."
    Tse W.T., Tang J., Jin O., Korsgren C., John K.M., Kung A.L., Gwynn B., Peters L.L., Lux S.E.
    J. Biol. Chem. 276:23974-23985(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 5), VARIANT SER-1331.
  2. "BetaIV spectrin, a new spectrin localized at axon initial segments and nodes of Ranvier in the central and peripheral nervous system."
    Berghs S., Aggujaro D., Dirkx R. Jr., Maksimova E., Stabach P., Hermel J.-M., Zhang J.-P., Philbrick W., Slepnev V., Ort T., Solimena M.
    J. Cell Biol. 151:985-1002(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4).
  3. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
    DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 386-2382 (ISOFORM 1).
    Tissue: Brain.

Entry informationi

Entry nameiSPTN4_HUMAN
AccessioniPrimary (citable) accession number: Q9H254
Secondary accession number(s): E9PGQ5
, Q9H1K7, Q9H1K8, Q9H1K9, Q9H253, Q9H3G8, Q9HCD0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: November 16, 2001
Last modified: September 3, 2014
This is version 129 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi