Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9H254

- SPTN4_HUMAN

UniProt

Q9H254 - SPTN4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Spectrin beta chain, non-erythrocytic 4

Gene

SPTBN4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  1. actin binding Source: UniProtKB
  2. ankyrin binding Source: UniProtKB
  3. phosphatase binding Source: BHF-UCL
  4. phospholipid binding Source: InterPro
  5. spectrin binding Source: BHF-UCL
  6. structural constituent of cytoskeleton Source: UniProtKB

GO - Biological processi

  1. actin filament capping Source: UniProtKB-KW
  2. adult walking behavior Source: BHF-UCL
  3. axon guidance Source: Reactome
  4. axonogenesis Source: BHF-UCL
  5. cardiac conduction Source: BHF-UCL
  6. central nervous system projection neuron axonogenesis Source: BHF-UCL
  7. clustering of voltage-gated sodium channels Source: BHF-UCL
  8. cytoskeletal anchoring at plasma membrane Source: UniProtKB
  9. establishment of protein localization to plasma membrane Source: BHF-UCL
  10. fertilization Source: Ensembl
  11. negative regulation of heart rate Source: BHF-UCL
  12. positive regulation of multicellular organism growth Source: Ensembl
  13. regulation of peptidyl-serine phosphorylation Source: BHF-UCL
  14. regulation of sodium ion transport Source: BHF-UCL
  15. sensory perception of sound Source: BHF-UCL
  16. transmission of nerve impulse Source: BHF-UCL
  17. vesicle-mediated transport Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Actin capping

Keywords - Ligandi

Actin-binding

Enzyme and pathway databases

ReactomeiREACT_18334. NCAM signaling for neurite out-growth.
REACT_22266. Interaction between L1 and Ankyrins.

Names & Taxonomyi

Protein namesi
Recommended name:
Spectrin beta chain, non-erythrocytic 4
Alternative name(s):
Beta-IV spectrin
Spectrin, non-erythroid beta chain 3
Gene namesi
Name:SPTBN4
Synonyms:KIAA1642, SPTBN3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:14896. SPTBN4.

Subcellular locationi

Cytoplasmcytoskeleton By similarity. Cytoplasmcell cortex By similarity

GO - Cellular componenti

  1. adherens junction Source: BHF-UCL
  2. axon hillock Source: BHF-UCL
  3. axon initial segment Source: BHF-UCL
  4. cell body fiber Source: BHF-UCL
  5. cytoplasm Source: UniProtKB
  6. cytosol Source: Reactome
  7. extracellular vesicular exosome Source: UniProtKB
  8. membrane Source: BHF-UCL
  9. neuronal cell body Source: BHF-UCL
  10. node of Ranvier Source: BHF-UCL
  11. nuclear matrix Source: UniProtKB
  12. paranode region of axon Source: Ensembl
  13. plasma membrane Source: BHF-UCL
  14. PML body Source: UniProtKB
  15. spectrin Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA37918.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 25642564Spectrin beta chain, non-erythrocytic 4PRO_0000073465Add
BLAST

Proteomic databases

MaxQBiQ9H254.
PaxDbiQ9H254.
PRIDEiQ9H254.

PTM databases

PhosphoSiteiQ9H254.

Expressioni

Tissue specificityi

Abundantly expressed in brain and pancreatic islets.

Gene expression databases

BgeeiQ9H254.
CleanExiHS_SPTBN4.
ExpressionAtlasiQ9H254. baseline and differential.
GenevestigatoriQ9H254.

Organism-specific databases

HPAiHPA043370.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
DISC1Q9NRI53EBI-308543,EBI-529989
PTPRNQ168492EBI-308543,EBI-728153

Protein-protein interaction databases

BioGridi121751. 14 interactions.
IntActiQ9H254. 12 interactions.
MINTiMINT-8247405.
STRINGi9606.ENSP00000263373.

Structurei

3D structure databases

ProteinModelPortaliQ9H254.
SMRiQ9H254. Positions 57-287, 309-2114, 2422-2525.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 282282Actin-bindingAdd
BLAST
Domaini61 – 165105CH 1PROSITE-ProRule annotationAdd
BLAST
Domaini180 – 282103CH 2PROSITE-ProRule annotationAdd
BLAST
Repeati309 – 35446Spectrin 1Add
BLAST
Repeati398 – 41922Spectrin 2Add
BLAST
Repeati429 – 533105Spectrin 3Add
BLAST
Repeati535 – 642108Spectrin 4Add
BLAST
Repeati644 – 771128Spectrin 5Add
BLAST
Repeati773 – 879107Spectrin 6Add
BLAST
Repeati881 – 985105Spectrin 7Add
BLAST
Repeati1019 – 108668Spectrin 8Add
BLAST
Repeati1088 – 1197110Spectrin 9Add
BLAST
Repeati1199 – 1303105Spectrin 10Add
BLAST
Repeati1305 – 1408104Spectrin 11Add
BLAST
Repeati1410 – 1513104Spectrin 12Add
BLAST
Repeati1515 – 1619105Spectrin 13Add
BLAST
Repeati1621 – 1725105Spectrin 14Add
BLAST
Repeati1727 – 1832106Spectrin 15Add
BLAST
Repeati1834 – 1940107Spectrin 16Add
BLAST
Repeati1942 – 2046105Spectrin 17Add
BLAST
Repeati2048 – 210760Spectrin 18Add
BLAST
Domaini2418 – 2527110PHPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the spectrin family.Curated
Contains 2 CH (calponin-homology) domains.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation
Contains 18 spectrin repeats.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiCOG5069.
GeneTreeiENSGT00760000118813.
HOGENOMiHOG000007281.
HOVERGENiHBG057912.
InParanoidiQ9H254.
KOiK06115.
OMAiRKEEMSA.
PhylomeDBiQ9H254.
TreeFamiTF313446.

Family and domain databases

Gene3Di1.10.418.10. 2 hits.
2.30.29.30. 1 hit.
InterProiIPR001589. Actinin_actin-bd_CS.
IPR001715. CH-domain.
IPR001605. PH_dom-spectrin-type.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR018159. Spectrin/alpha-actinin.
IPR016343. Spectrin_bsu.
IPR002017. Spectrin_repeat.
[Graphical view]
PfamiPF00307. CH. 2 hits.
PF00435. Spectrin. 14 hits.
[Graphical view]
PIRSFiPIRSF002297. Spectrin_beta_subunit. 1 hit.
PRINTSiPR00683. SPECTRINPH.
SMARTiSM00033. CH. 2 hits.
SM00233. PH. 1 hit.
SM00150. SPEC. 16 hits.
[Graphical view]
SUPFAMiSSF47576. SSF47576. 1 hit.
PROSITEiPS00019. ACTININ_1. 1 hit.
PS00020. ACTININ_2. 1 hit.
PS50021. CH. 2 hits.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9H254-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAQVPGEVDN MEGLPAPNNN PAARWESPDR GWEREQPAAS TAAASLFECS
60 70 80 90 100
RIKALADERE AVQKKTFTKW VNSHLARVGC HIGDLYVDLR DGFVLTRLLE
110 120 130 140 150
VLSGEQLPRP TRGRMRIHSL ENVDKALQFL KEQRVHLENV GSHDIVDGNH
160 170 180 190 200
RLTLGLVWTI ILRFQIQVIK IETEDNRETR SAKDALLLWC QMKTAGYPEV
210 220 230 240 250
NIQNFTTSWR DGLAFNALIH RHRPDLVDFS KLTKSNANYN LQRAFRTAEQ
260 270 280 290 300
HLGLARLLDP EDVNMEAPDE KSIITYVVSF YHYFSKMKAL AVEGKRIGKV
310 320 330 340 350
LDQVLEVGKI IERYEELAAE LLAWIHRTVG LISNQKFANS LSGVQQQLQA
360 370 380 390 400
FTAYCTLEKP VKFQEKGNLE VLLFSIQSKL RACNRRLFVP REGCGIWDID
410 420 430 440 450
KAWGELEKAE HEREAALRAE LIRQEKLELL AQRFDHKVAM RESWLNENQR
460 470 480 490 500
LVSQDNFGYE LPAVEAAMKK HEAIEADIAA YEERVQGVAE LAQALAAEGY
510 520 530 540 550
YDIRRVAAQR DSVLRQWALL TGLVGARRTR LEQNLALQKV FQEMVYMVDW
560 570 580 590 600
MEEMQAQLLS RECGQHLVEA DDLLQKHGLL EGDIAAQSER VEALNAAALR
610 620 630 640 650
FSQLQGYQPC DPQVICNRVN HVHGCLAELQ EQAARRRAEL EASRSLWALL
660 670 680 690 700
QELEEAESWA RDKERLLEAA GGGGAAGAAG AAGTAGGAHD LSSTARLLAQ
710 720 730 740 750
HKILQGELGG RRALLQQALR CGEELVAAGG AVGPGADTVH LVGLAERAAS
760 770 780 790 800
ARRRWQRLEE AAARRERRLQ EARALHQFGA DLDGLLDWLR DAYRLAAAGD
810 820 830 840 850
FGHDEASSRR LARQHRALTG EVEAHRGPVS GLRRQLATLG GASGAGPLVV
860 870 880 890 900
ALQVRVVEAE QLFAEVTEVA ALRRQWLRDA LAVYRMFGEV HACELWIGEK
910 920 930 940 950
EQWLLSMRVP DSLDDVEVVQ HRFESLDQEM NSLMGRVLDV NHTVQELVEG
960 970 980 990 1000
GHPSSDEVRS CQDHLNSRWN RIVELVEQRK EEMSAVLLVE NHVLEVAEVR
1010 1020 1030 1040 1050
AQVREKRRAV ESAPRAGGAL QWRLSGLEAA LQALEPRQAA LLEEAALLAE
1060 1070 1080 1090 1100
RFPAQAARLH QGAEELGAEW GALASAAQAC GEAVAAAGRL QRFLHDLDAF
1110 1120 1130 1140 1150
LDWLVRAQEA AGGSEGPLPN SLEEADALLA RHAALKEEVD QREEDYARIV
1160 1170 1180 1190 1200
AASEALLAAD GAELGPGLAL DEWLPHLELG WHKLLGLWEA RREALVQAHI
1210 1220 1230 1240 1250
YQLFLRDLRQ ALVVLRNQEM ALSGAELPGT VESVEEALKQ HRDFLTTMEL
1260 1270 1280 1290 1300
SQQKMQVAVQ AAEGLLRQGN IYGEQAQEAV TRLLEKNQEN QLRAQQWMQK
1310 1320 1330 1340 1350
LHDQLELQHF LRDCHELDGW IHEKMLMARD GTREDNHKLH KRWLRHQAFM
1360 1370 1380 1390 1400
AELAQNKEWL EKIEREGQQL MQEKPELAAS VRKKLGEIRQ CWAELESTTQ
1410 1420 1430 1440 1450
AKARQLFEAS KADQLVQSFA ELDKKLLHME SQLQDVDPGG DLATVNSQLK
1460 1470 1480 1490 1500
KLQSMESQVE EWYREVGELQ AQTAALPLEP ASKELVGERQ NAVGERLVRL
1510 1520 1530 1540 1550
LEPLQERRRL LLASKELHQV AHDLDDELAW VQERLPLAMQ TERGNGLQAV
1560 1570 1580 1590 1600
QQHIKKNQGL RREIQAHGPR LEEVLERAGA LASLRSPEAE AVRRGLEQLQ
1610 1620 1630 1640 1650
SAWAGLREAA ERRQQVLDAA FQVEQYYFDV AEVEAWLGEQ ELLMMSEDKG
1660 1670 1680 1690 1700
KDEQSTLQLL KKHLQLEQGV ENYEESIAQL SRQCRALLEM GHPDSEQISR
1710 1720 1730 1740 1750
RQSQVDRLYV ALKELGEERR VALEQQYWLY QLSRQVSELE HWIAEKEVVA
1760 1770 1780 1790 1800
GSPELGQDFE HVSVLQEKFS EFASETGMAG RERLAAVNQM VDELIECGHT
1810 1820 1830 1840 1850
AAATMAEWKD GLNEAWAELL ELMGTRAQLL AASRELHKFF SDARELQGQI
1860 1870 1880 1890 1900
EEKRRRLPRL TTPPEPRPSA SSMQRTLRAF EHDLQLLVSQ VRQLQEGAAQ
1910 1920 1930 1940 1950
LRTVYAGEHA EAIASREQEV LQGWKELLSA CEDARLHVSS TADALRFHSQ
1960 1970 1980 1990 2000
VRDLLSWMDG IASQIGAADK PRDVSSVEVL MNYHQGLKTE LEARVPELTT
2010 2020 2030 2040 2050
CQELGRSLLL NKSAMADEIQ AQLDKLGTRK EEVSEKWDRH WEWLQQMLEV
2060 2070 2080 2090 2100
HQFAQEAVVA DAWLTAQEPL LQSRELGSSV DEVEQLIRRH EAFRKAAAAW
2110 2120 2130 2140 2150
EERFSSLRRL TTIEKIKAEQ SKQPPTPLLG RKFFGDPTEL AAKAAPLLRP
2160 2170 2180 2190 2200
GGYERGLEPL ARRASDTLSA EVRTRVGYVR QELKPERLQP RIDRLPEIPG
2210 2220 2230 2240 2250
RVEPAALPAA PEDAAETPAT PAAAEQVRPR PERQESADRA EELPRRRRPE
2260 2270 2280 2290 2300
RQESVDQSEE AARRRRPERQ ESAEHEAAHS LTLGRYEQME RRRERRERRL
2310 2320 2330 2340 2350
ERQESSEQEM PIRGDLVKGK ATLADIVEQL QEKEAGPGLP AGPSLPQPRE
2360 2370 2380 2390 2400
LPPGRLPNGL ELPERTPRPD RPRARDRPKP RRRPRPREGG EGGGSRRSRS
2410 2420 2430 2440 2450
APAQGGSAPA PPPPPTHTVQ HEGFLLRKRE LDANRKSSNR SWVSLYCVLS
2460 2470 2480 2490 2500
KGELGFYKDS KGPASGSTHG GEPLLSLHKA TSEVASDYKK KKHVFKLQTQ
2510 2520 2530 2540 2550
DGSEFLLQAK DEEEMNGWLE AVASSVAEHA EIARWGQTLP TTSSTDEGNP
2560
KREGGDRRAS GRRK
Length:2,564
Mass (Da):288,985
Last modified:November 16, 2001 - v2
Checksum:i52CDE7D11D601ECC
GO
Isoform 2 (identifier: Q9H254-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1287-1309: NQENQLRAQQWMQKLHDQLELQH → CLIIHPALLHPPWEPPYLPRSSS
     1310-2564: Missing.

Show »
Length:1,309
Mass (Da):146,169
Checksum:i7EC61D92DAC5479C
GO
Isoform 3 (identifier: Q9H254-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1257: Missing.
     1258-1286: AVQAAEGLLRQGNIYGEQAQEAVTRLLEK → MPHYPSCSSAPSLGTPIPPQIQQLEARHR

Show »
Length:1,307
Mass (Da):148,622
Checksum:i1CE0DB8C9686B90E
GO
Isoform 4 (identifier: Q9H254-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2113-2154: IEKIKAEQSK...APLLRPGGYE → PRREDHLNPG...KTARRDGTCL
     2155-2564: Missing.

Show »
Length:2,154
Mass (Da):243,424
Checksum:iB36417A996D80609
GO
Isoform 5 (identifier: Q9H254-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1324: Missing.
     1973-2002: DVSSVEVLMNYHQGLKTELEARVPELTTCQ → CPSSLLGLPASPWWPTPATPSPLTAPFSME
     2003-2564: Missing.

Show »
Length:678
Mass (Da):77,167
Checksum:i53C7058D7A66F4B9
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti604 – 6085Missing in AAG38874. (PubMed:11086001)Curated
Sequence conflicti604 – 6085Missing in AAF93171. (PubMed:11086001)Curated
Sequence conflicti714 – 7141L → S in AAG38874. (PubMed:11086001)Curated
Sequence conflicti714 – 7141L → S in AAF93171. (PubMed:11086001)Curated
Sequence conflicti714 – 7141L → S in AAF93173. (PubMed:11086001)Curated
Sequence conflicti1189 – 11891E → K in AAG38874. (PubMed:11086001)Curated
Sequence conflicti1189 – 11891E → K in AAF93171. (PubMed:11086001)Curated
Sequence conflicti1189 – 11891E → K in AAF93173. (PubMed:11086001)Curated
Sequence conflicti1193 – 11931E → K in AAG38874. (PubMed:11086001)Curated
Sequence conflicti1193 – 11931E → K in AAF93171. (PubMed:11086001)Curated
Sequence conflicti1193 – 11931E → K in AAF93173. (PubMed:11086001)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti1331 – 13311G → S.1 Publication
Corresponds to variant rs814501 [ dbSNP | Ensembl ].
VAR_048632

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 13241324Missing in isoform 5. 1 PublicationVSP_046383Add
BLAST
Alternative sequencei1 – 12571257Missing in isoform 3. 1 PublicationVSP_000723Add
BLAST
Alternative sequencei1258 – 128629AVQAA…RLLEK → MPHYPSCSSAPSLGTPIPPQ IQQLEARHR in isoform 3. 1 PublicationVSP_000724Add
BLAST
Alternative sequencei1287 – 130923NQENQ…LELQH → CLIIHPALLHPPWEPPYLPR SSS in isoform 2. 1 PublicationVSP_000725Add
BLAST
Alternative sequencei1310 – 25641255Missing in isoform 2. 1 PublicationVSP_000726Add
BLAST
Alternative sequencei1973 – 200230DVSSV…LTTCQ → CPSSLLGLPASPWWPTPATP SPLTAPFSME in isoform 5. 1 PublicationVSP_046384Add
BLAST
Alternative sequencei2003 – 2564562Missing in isoform 5. 1 PublicationVSP_046385Add
BLAST
Alternative sequencei2113 – 215442IEKIK…PGGYE → PRREDHLNPGVQDQPWQHTE KPSLPKPKANKEKTARRDGT CL in isoform 4. 1 PublicationVSP_000727Add
BLAST
Alternative sequencei2155 – 2564410Missing in isoform 4. 1 PublicationVSP_000728Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF311855 mRNA. Translation: AAG42473.1.
AF311856 mRNA. Translation: AAG42474.1.
AF082075 mRNA. Translation: AAG38874.1.
AY004226 mRNA. Translation: AAF93171.1.
AY004226 mRNA. Translation: AAF93172.1.
AY004227 mRNA. Translation: AAF93173.1.
AC020929 Genomic DNA. No translation available.
AB046862 mRNA. Translation: BAB13468.1.
CCDSiCCDS12559.1. [Q9H254-1]
CCDS42569.1. [Q9H254-5]
RefSeqiNP_066022.2. NM_020971.2. [Q9H254-1]
NP_079489.2. NM_025213.2. [Q9H254-5]
UniGeneiHs.32706.

Genome annotation databases

EnsembliENST00000352632; ENSP00000263373; ENSG00000160460. [Q9H254-1]
ENST00000392023; ENSP00000375877; ENSG00000160460. [Q9H254-5]
ENST00000598249; ENSP00000469242; ENSG00000160460. [Q9H254-1]
GeneIDi57731.
KEGGihsa:57731.
UCSCiuc002onx.3. human. [Q9H254-1]

Polymorphism databases

DMDMi17368942.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF311855 mRNA. Translation: AAG42473.1 .
AF311856 mRNA. Translation: AAG42474.1 .
AF082075 mRNA. Translation: AAG38874.1 .
AY004226 mRNA. Translation: AAF93171.1 .
AY004226 mRNA. Translation: AAF93172.1 .
AY004227 mRNA. Translation: AAF93173.1 .
AC020929 Genomic DNA. No translation available.
AB046862 mRNA. Translation: BAB13468.1 .
CCDSi CCDS12559.1. [Q9H254-1 ]
CCDS42569.1. [Q9H254-5 ]
RefSeqi NP_066022.2. NM_020971.2. [Q9H254-1 ]
NP_079489.2. NM_025213.2. [Q9H254-5 ]
UniGenei Hs.32706.

3D structure databases

ProteinModelPortali Q9H254.
SMRi Q9H254. Positions 57-287, 309-2114, 2422-2525.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 121751. 14 interactions.
IntActi Q9H254. 12 interactions.
MINTi MINT-8247405.
STRINGi 9606.ENSP00000263373.

PTM databases

PhosphoSitei Q9H254.

Polymorphism databases

DMDMi 17368942.

Proteomic databases

MaxQBi Q9H254.
PaxDbi Q9H254.
PRIDEi Q9H254.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000352632 ; ENSP00000263373 ; ENSG00000160460 . [Q9H254-1 ]
ENST00000392023 ; ENSP00000375877 ; ENSG00000160460 . [Q9H254-5 ]
ENST00000598249 ; ENSP00000469242 ; ENSG00000160460 . [Q9H254-1 ]
GeneIDi 57731.
KEGGi hsa:57731.
UCSCi uc002onx.3. human. [Q9H254-1 ]

Organism-specific databases

CTDi 57731.
GeneCardsi GC19P040973.
H-InvDB HIX0015138.
HGNCi HGNC:14896. SPTBN4.
HPAi HPA043370.
MIMi 606214. gene.
neXtProti NX_Q9H254.
PharmGKBi PA37918.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5069.
GeneTreei ENSGT00760000118813.
HOGENOMi HOG000007281.
HOVERGENi HBG057912.
InParanoidi Q9H254.
KOi K06115.
OMAi RKEEMSA.
PhylomeDBi Q9H254.
TreeFami TF313446.

Enzyme and pathway databases

Reactomei REACT_18334. NCAM signaling for neurite out-growth.
REACT_22266. Interaction between L1 and Ankyrins.

Miscellaneous databases

GeneWikii SPTBN4.
GenomeRNAii 57731.
NextBioi 64688.
PROi Q9H254.
SOURCEi Search...

Gene expression databases

Bgeei Q9H254.
CleanExi HS_SPTBN4.
ExpressionAtlasi Q9H254. baseline and differential.
Genevestigatori Q9H254.

Family and domain databases

Gene3Di 1.10.418.10. 2 hits.
2.30.29.30. 1 hit.
InterProi IPR001589. Actinin_actin-bd_CS.
IPR001715. CH-domain.
IPR001605. PH_dom-spectrin-type.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR018159. Spectrin/alpha-actinin.
IPR016343. Spectrin_bsu.
IPR002017. Spectrin_repeat.
[Graphical view ]
Pfami PF00307. CH. 2 hits.
PF00435. Spectrin. 14 hits.
[Graphical view ]
PIRSFi PIRSF002297. Spectrin_beta_subunit. 1 hit.
PRINTSi PR00683. SPECTRINPH.
SMARTi SM00033. CH. 2 hits.
SM00233. PH. 1 hit.
SM00150. SPEC. 16 hits.
[Graphical view ]
SUPFAMi SSF47576. SSF47576. 1 hit.
PROSITEi PS00019. ACTININ_1. 1 hit.
PS00020. ACTININ_2. 1 hit.
PS50021. CH. 2 hits.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A new spectrin, beta-IV, has a major truncated isoform that associates with promyelocytic leukemia protein nuclear bodies and the nuclear matrix."
    Tse W.T., Tang J., Jin O., Korsgren C., John K.M., Kung A.L., Gwynn B., Peters L.L., Lux S.E.
    J. Biol. Chem. 276:23974-23985(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 5), VARIANT SER-1331.
  2. "BetaIV spectrin, a new spectrin localized at axon initial segments and nodes of Ranvier in the central and peripheral nervous system."
    Berghs S., Aggujaro D., Dirkx R. Jr., Maksimova E., Stabach P., Hermel J.-M., Zhang J.-P., Philbrick W., Slepnev V., Ort T., Solimena M.
    J. Cell Biol. 151:985-1002(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4).
  3. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
    DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 386-2382 (ISOFORM 1).
    Tissue: Brain.

Entry informationi

Entry nameiSPTN4_HUMAN
AccessioniPrimary (citable) accession number: Q9H254
Secondary accession number(s): E9PGQ5
, Q9H1K7, Q9H1K8, Q9H1K9, Q9H253, Q9H3G8, Q9HCD0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: November 16, 2001
Last modified: November 26, 2014
This is version 132 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3