Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9H254 (SPTN4_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 128. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Spectrin beta chain, non-erythrocytic 4
Alternative name(s):
Beta-IV spectrin
Spectrin, non-erythroid beta chain 3
Gene names
Name:SPTBN4
Synonyms:KIAA1642, SPTBN3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length2564 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Subcellular location

Cytoplasmcytoskeleton By similarity. Cytoplasmcell cortex By similarity.

Tissue specificity

Abundantly expressed in brain and pancreatic islets.

Sequence similarities

Belongs to the spectrin family.

Contains 2 CH (calponin-homology) domains.

Contains 1 PH domain.

Contains 18 spectrin repeats.

Ontologies

Keywords
   Cellular componentCytoplasm
Cytoskeleton
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainRepeat
   LigandActin-binding
   Molecular functionActin capping
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processactin filament capping

Inferred from electronic annotation. Source: UniProtKB-KW

adult walking behavior

Inferred from sequence or structural similarity. Source: BHF-UCL

axon guidance

Traceable author statement. Source: Reactome

axonogenesis

Inferred from sequence or structural similarity. Source: BHF-UCL

cardiac conduction

Inferred from sequence or structural similarity. Source: BHF-UCL

central nervous system projection neuron axonogenesis

Inferred from sequence or structural similarity. Source: BHF-UCL

clustering of voltage-gated sodium channels

Inferred from sequence or structural similarity. Source: BHF-UCL

cytoskeletal anchoring at plasma membrane

Traceable author statement Ref.2. Source: UniProtKB

establishment of protein localization to plasma membrane

Inferred from sequence or structural similarity. Source: BHF-UCL

fertilization

Inferred from electronic annotation. Source: Ensembl

negative regulation of heart rate

Inferred from sequence or structural similarity. Source: BHF-UCL

positive regulation of multicellular organism growth

Inferred from electronic annotation. Source: Ensembl

regulation of peptidyl-serine phosphorylation

Inferred from sequence or structural similarity. Source: BHF-UCL

regulation of sodium ion transport

Inferred from sequence or structural similarity. Source: BHF-UCL

sensory perception of sound

Inferred from sequence or structural similarity. Source: BHF-UCL

transmission of nerve impulse

Inferred from sequence or structural similarity. Source: BHF-UCL

vesicle-mediated transport

Traceable author statement Ref.1. Source: UniProtKB

   Cellular_componentPML body

Inferred from direct assay Ref.1. Source: UniProtKB

adherens junction

Inferred from sequence or structural similarity. Source: BHF-UCL

axon hillock

Inferred from sequence or structural similarity. Source: BHF-UCL

axon initial segment

Inferred from sequence or structural similarity. Source: BHF-UCL

cell body fiber

Inferred from sequence or structural similarity. Source: BHF-UCL

cytoplasm

Inferred from direct assay Ref.1. Source: UniProtKB

cytosol

Traceable author statement. Source: Reactome

membrane

Inferred from direct assay Ref.2. Source: BHF-UCL

neuronal cell body

Inferred from sequence or structural similarity. Source: BHF-UCL

node of Ranvier

Inferred from sequence or structural similarity. Source: BHF-UCL

nuclear matrix

Inferred from direct assay Ref.1. Source: UniProtKB

paranode region of axon

Inferred from electronic annotation. Source: Ensembl

plasma membrane

Inferred from sequence or structural similarity. Source: BHF-UCL

spectrin

Inferred from direct assay Ref.2. Source: UniProtKB

   Molecular_functionactin binding

Traceable author statement Ref.2. Source: UniProtKB

ankyrin binding

Inferred from direct assay Ref.1. Source: UniProtKB

phosphatase binding

Inferred from physical interaction Ref.2. Source: BHF-UCL

phospholipid binding

Inferred from electronic annotation. Source: InterPro

protein binding

Inferred from physical interaction Ref.2PubMed 12812986. Source: IntAct

spectrin binding

Inferred from sequence or structural similarity. Source: BHF-UCL

structural constituent of cytoskeleton

Traceable author statement Ref.1. Source: UniProtKB

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

DISC1Q9NRI53EBI-308543,EBI-529989
PTPRNQ168492EBI-308543,EBI-728153

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9H254-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9H254-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1287-1309: NQENQLRAQQWMQKLHDQLELQH → CLIIHPALLHPPWEPPYLPRSSS
     1310-2564: Missing.
Isoform 3 (identifier: Q9H254-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1257: Missing.
     1258-1286: AVQAAEGLLRQGNIYGEQAQEAVTRLLEK → MPHYPSCSSAPSLGTPIPPQIQQLEARHR
Isoform 4 (identifier: Q9H254-4)

The sequence of this isoform differs from the canonical sequence as follows:
     2113-2154: IEKIKAEQSK...APLLRPGGYE → PRREDHLNPG...KTARRDGTCL
     2155-2564: Missing.
Isoform 5 (identifier: Q9H254-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1324: Missing.
     1973-2002: DVSSVEVLMNYHQGLKTELEARVPELTTCQ → CPSSLLGLPASPWWPTPATPSPLTAPFSME
     2003-2564: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 25642564Spectrin beta chain, non-erythrocytic 4
PRO_0000073465

Regions

Domain1 – 282282Actin-binding
Domain61 – 165105CH 1
Domain180 – 282103CH 2
Repeat309 – 35446Spectrin 1
Repeat398 – 41922Spectrin 2
Repeat429 – 533105Spectrin 3
Repeat535 – 642108Spectrin 4
Repeat644 – 771128Spectrin 5
Repeat773 – 879107Spectrin 6
Repeat881 – 985105Spectrin 7
Repeat1019 – 108668Spectrin 8
Repeat1088 – 1197110Spectrin 9
Repeat1199 – 1303105Spectrin 10
Repeat1305 – 1408104Spectrin 11
Repeat1410 – 1513104Spectrin 12
Repeat1515 – 1619105Spectrin 13
Repeat1621 – 1725105Spectrin 14
Repeat1727 – 1832106Spectrin 15
Repeat1834 – 1940107Spectrin 16
Repeat1942 – 2046105Spectrin 17
Repeat2048 – 210760Spectrin 18
Domain2418 – 2527110PH

Natural variations

Alternative sequence1 – 13241324Missing in isoform 5.
VSP_046383
Alternative sequence1 – 12571257Missing in isoform 3.
VSP_000723
Alternative sequence1258 – 128629AVQAA…RLLEK → MPHYPSCSSAPSLGTPIPPQ IQQLEARHR in isoform 3.
VSP_000724
Alternative sequence1287 – 130923NQENQ…LELQH → CLIIHPALLHPPWEPPYLPR SSS in isoform 2.
VSP_000725
Alternative sequence1310 – 25641255Missing in isoform 2.
VSP_000726
Alternative sequence1973 – 200230DVSSV…LTTCQ → CPSSLLGLPASPWWPTPATP SPLTAPFSME in isoform 5.
VSP_046384
Alternative sequence2003 – 2564562Missing in isoform 5.
VSP_046385
Alternative sequence2113 – 215442IEKIK…PGGYE → PRREDHLNPGVQDQPWQHTE KPSLPKPKANKEKTARRDGT CL in isoform 4.
VSP_000727
Alternative sequence2155 – 2564410Missing in isoform 4.
VSP_000728
Natural variant13311G → S. Ref.1
Corresponds to variant rs814501 [ dbSNP | Ensembl ].
VAR_048632

Experimental info

Sequence conflict604 – 6085Missing in AAG38874. Ref.2
Sequence conflict604 – 6085Missing in AAF93171. Ref.2
Sequence conflict7141L → S in AAG38874. Ref.2
Sequence conflict7141L → S in AAF93171. Ref.2
Sequence conflict7141L → S in AAF93173. Ref.2
Sequence conflict11891E → K in AAG38874. Ref.2
Sequence conflict11891E → K in AAF93171. Ref.2
Sequence conflict11891E → K in AAF93173. Ref.2
Sequence conflict11931E → K in AAG38874. Ref.2
Sequence conflict11931E → K in AAF93171. Ref.2
Sequence conflict11931E → K in AAF93173. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 16, 2001. Version 2.
Checksum: 52CDE7D11D601ECC

FASTA2,564288,985
        10         20         30         40         50         60 
MAQVPGEVDN MEGLPAPNNN PAARWESPDR GWEREQPAAS TAAASLFECS RIKALADERE 

        70         80         90        100        110        120 
AVQKKTFTKW VNSHLARVGC HIGDLYVDLR DGFVLTRLLE VLSGEQLPRP TRGRMRIHSL 

       130        140        150        160        170        180 
ENVDKALQFL KEQRVHLENV GSHDIVDGNH RLTLGLVWTI ILRFQIQVIK IETEDNRETR 

       190        200        210        220        230        240 
SAKDALLLWC QMKTAGYPEV NIQNFTTSWR DGLAFNALIH RHRPDLVDFS KLTKSNANYN 

       250        260        270        280        290        300 
LQRAFRTAEQ HLGLARLLDP EDVNMEAPDE KSIITYVVSF YHYFSKMKAL AVEGKRIGKV 

       310        320        330        340        350        360 
LDQVLEVGKI IERYEELAAE LLAWIHRTVG LISNQKFANS LSGVQQQLQA FTAYCTLEKP 

       370        380        390        400        410        420 
VKFQEKGNLE VLLFSIQSKL RACNRRLFVP REGCGIWDID KAWGELEKAE HEREAALRAE 

       430        440        450        460        470        480 
LIRQEKLELL AQRFDHKVAM RESWLNENQR LVSQDNFGYE LPAVEAAMKK HEAIEADIAA 

       490        500        510        520        530        540 
YEERVQGVAE LAQALAAEGY YDIRRVAAQR DSVLRQWALL TGLVGARRTR LEQNLALQKV 

       550        560        570        580        590        600 
FQEMVYMVDW MEEMQAQLLS RECGQHLVEA DDLLQKHGLL EGDIAAQSER VEALNAAALR 

       610        620        630        640        650        660 
FSQLQGYQPC DPQVICNRVN HVHGCLAELQ EQAARRRAEL EASRSLWALL QELEEAESWA 

       670        680        690        700        710        720 
RDKERLLEAA GGGGAAGAAG AAGTAGGAHD LSSTARLLAQ HKILQGELGG RRALLQQALR 

       730        740        750        760        770        780 
CGEELVAAGG AVGPGADTVH LVGLAERAAS ARRRWQRLEE AAARRERRLQ EARALHQFGA 

       790        800        810        820        830        840 
DLDGLLDWLR DAYRLAAAGD FGHDEASSRR LARQHRALTG EVEAHRGPVS GLRRQLATLG 

       850        860        870        880        890        900 
GASGAGPLVV ALQVRVVEAE QLFAEVTEVA ALRRQWLRDA LAVYRMFGEV HACELWIGEK 

       910        920        930        940        950        960 
EQWLLSMRVP DSLDDVEVVQ HRFESLDQEM NSLMGRVLDV NHTVQELVEG GHPSSDEVRS 

       970        980        990       1000       1010       1020 
CQDHLNSRWN RIVELVEQRK EEMSAVLLVE NHVLEVAEVR AQVREKRRAV ESAPRAGGAL 

      1030       1040       1050       1060       1070       1080 
QWRLSGLEAA LQALEPRQAA LLEEAALLAE RFPAQAARLH QGAEELGAEW GALASAAQAC 

      1090       1100       1110       1120       1130       1140 
GEAVAAAGRL QRFLHDLDAF LDWLVRAQEA AGGSEGPLPN SLEEADALLA RHAALKEEVD 

      1150       1160       1170       1180       1190       1200 
QREEDYARIV AASEALLAAD GAELGPGLAL DEWLPHLELG WHKLLGLWEA RREALVQAHI 

      1210       1220       1230       1240       1250       1260 
YQLFLRDLRQ ALVVLRNQEM ALSGAELPGT VESVEEALKQ HRDFLTTMEL SQQKMQVAVQ 

      1270       1280       1290       1300       1310       1320 
AAEGLLRQGN IYGEQAQEAV TRLLEKNQEN QLRAQQWMQK LHDQLELQHF LRDCHELDGW 

      1330       1340       1350       1360       1370       1380 
IHEKMLMARD GTREDNHKLH KRWLRHQAFM AELAQNKEWL EKIEREGQQL MQEKPELAAS 

      1390       1400       1410       1420       1430       1440 
VRKKLGEIRQ CWAELESTTQ AKARQLFEAS KADQLVQSFA ELDKKLLHME SQLQDVDPGG 

      1450       1460       1470       1480       1490       1500 
DLATVNSQLK KLQSMESQVE EWYREVGELQ AQTAALPLEP ASKELVGERQ NAVGERLVRL 

      1510       1520       1530       1540       1550       1560 
LEPLQERRRL LLASKELHQV AHDLDDELAW VQERLPLAMQ TERGNGLQAV QQHIKKNQGL 

      1570       1580       1590       1600       1610       1620 
RREIQAHGPR LEEVLERAGA LASLRSPEAE AVRRGLEQLQ SAWAGLREAA ERRQQVLDAA 

      1630       1640       1650       1660       1670       1680 
FQVEQYYFDV AEVEAWLGEQ ELLMMSEDKG KDEQSTLQLL KKHLQLEQGV ENYEESIAQL 

      1690       1700       1710       1720       1730       1740 
SRQCRALLEM GHPDSEQISR RQSQVDRLYV ALKELGEERR VALEQQYWLY QLSRQVSELE 

      1750       1760       1770       1780       1790       1800 
HWIAEKEVVA GSPELGQDFE HVSVLQEKFS EFASETGMAG RERLAAVNQM VDELIECGHT 

      1810       1820       1830       1840       1850       1860 
AAATMAEWKD GLNEAWAELL ELMGTRAQLL AASRELHKFF SDARELQGQI EEKRRRLPRL 

      1870       1880       1890       1900       1910       1920 
TTPPEPRPSA SSMQRTLRAF EHDLQLLVSQ VRQLQEGAAQ LRTVYAGEHA EAIASREQEV 

      1930       1940       1950       1960       1970       1980 
LQGWKELLSA CEDARLHVSS TADALRFHSQ VRDLLSWMDG IASQIGAADK PRDVSSVEVL 

      1990       2000       2010       2020       2030       2040 
MNYHQGLKTE LEARVPELTT CQELGRSLLL NKSAMADEIQ AQLDKLGTRK EEVSEKWDRH 

      2050       2060       2070       2080       2090       2100 
WEWLQQMLEV HQFAQEAVVA DAWLTAQEPL LQSRELGSSV DEVEQLIRRH EAFRKAAAAW 

      2110       2120       2130       2140       2150       2160 
EERFSSLRRL TTIEKIKAEQ SKQPPTPLLG RKFFGDPTEL AAKAAPLLRP GGYERGLEPL 

      2170       2180       2190       2200       2210       2220 
ARRASDTLSA EVRTRVGYVR QELKPERLQP RIDRLPEIPG RVEPAALPAA PEDAAETPAT 

      2230       2240       2250       2260       2270       2280 
PAAAEQVRPR PERQESADRA EELPRRRRPE RQESVDQSEE AARRRRPERQ ESAEHEAAHS 

      2290       2300       2310       2320       2330       2340 
LTLGRYEQME RRRERRERRL ERQESSEQEM PIRGDLVKGK ATLADIVEQL QEKEAGPGLP 

      2350       2360       2370       2380       2390       2400 
AGPSLPQPRE LPPGRLPNGL ELPERTPRPD RPRARDRPKP RRRPRPREGG EGGGSRRSRS 

      2410       2420       2430       2440       2450       2460 
APAQGGSAPA PPPPPTHTVQ HEGFLLRKRE LDANRKSSNR SWVSLYCVLS KGELGFYKDS 

      2470       2480       2490       2500       2510       2520 
KGPASGSTHG GEPLLSLHKA TSEVASDYKK KKHVFKLQTQ DGSEFLLQAK DEEEMNGWLE 

      2530       2540       2550       2560 
AVASSVAEHA EIARWGQTLP TTSSTDEGNP KREGGDRRAS GRRK 

« Hide

Isoform 2 [UniParc].

Checksum: 7EC61D92DAC5479C
Show »

FASTA1,309146,169
Isoform 3 [UniParc].

Checksum: 1CE0DB8C9686B90E
Show »

FASTA1,307148,622
Isoform 4 [UniParc].

Checksum: B36417A996D80609
Show »

FASTA2,154243,424
Isoform 5 [UniParc].

Checksum: 53C7058D7A66F4B9
Show »

FASTA67877,167

References

« Hide 'large scale' references
[1]"A new spectrin, beta-IV, has a major truncated isoform that associates with promyelocytic leukemia protein nuclear bodies and the nuclear matrix."
Tse W.T., Tang J., Jin O., Korsgren C., John K.M., Kung A.L., Gwynn B., Peters L.L., Lux S.E.
J. Biol. Chem. 276:23974-23985(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 5), VARIANT SER-1331.
[2]"BetaIV spectrin, a new spectrin localized at axon initial segments and nodes of Ranvier in the central and peripheral nervous system."
Berghs S., Aggujaro D., Dirkx R. Jr., Maksimova E., Stabach P., Hermel J.-M., Zhang J.-P., Philbrick W., Slepnev V., Ort T., Solimena M.
J. Cell Biol. 151:985-1002(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4).
[3]"The DNA sequence and biology of human chromosome 19."
Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. expand/collapse author list , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 386-2382 (ISOFORM 1).
Tissue: Brain.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF311855 mRNA. Translation: AAG42473.1.
AF311856 mRNA. Translation: AAG42474.1.
AF082075 mRNA. Translation: AAG38874.1.
AY004226 mRNA. Translation: AAF93171.1.
AY004226 mRNA. Translation: AAF93172.1.
AY004227 mRNA. Translation: AAF93173.1.
AC020929 Genomic DNA. No translation available.
AB046862 mRNA. Translation: BAB13468.1.
CCDSCCDS12559.1. [Q9H254-1]
CCDS42569.1. [Q9H254-5]
RefSeqNP_066022.2. NM_020971.2. [Q9H254-1]
NP_079489.2. NM_025213.2. [Q9H254-5]
UniGeneHs.32706.

3D structure databases

ProteinModelPortalQ9H254.
SMRQ9H254. Positions 55-287, 309-2114, 2422-2525.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid121751. 13 interactions.
IntActQ9H254. 12 interactions.
MINTMINT-8247405.
STRING9606.ENSP00000263373.

PTM databases

PhosphoSiteQ9H254.

Polymorphism databases

DMDM17368942.

Proteomic databases

MaxQBQ9H254.
PaxDbQ9H254.
PRIDEQ9H254.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000338932; ENSP00000340345; ENSG00000160460. [Q9H254-4]
ENST00000352632; ENSP00000263373; ENSG00000160460. [Q9H254-1]
ENST00000392023; ENSP00000375877; ENSG00000160460. [Q9H254-5]
ENST00000598249; ENSP00000469242; ENSG00000160460. [Q9H254-1]
GeneID57731.
KEGGhsa:57731.
UCSCuc002onx.3. human. [Q9H254-1]

Organism-specific databases

CTD57731.
GeneCardsGC19P040973.
H-InvDBHIX0015138.
HGNCHGNC:14896. SPTBN4.
HPAHPA043370.
MIM606214. gene.
neXtProtNX_Q9H254.
PharmGKBPA37918.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5069.
HOGENOMHOG000007281.
HOVERGENHBG057912.
InParanoidQ9H254.
KOK06115.
OMARKEEMSA.
PhylomeDBQ9H254.
TreeFamTF313446.

Enzyme and pathway databases

ReactomeREACT_111045. Developmental Biology.
REACT_188576. Developmental Biology.

Gene expression databases

ArrayExpressQ9H254.
BgeeQ9H254.
CleanExHS_SPTBN4.
GenevestigatorQ9H254.

Family and domain databases

Gene3D1.10.418.10. 2 hits.
2.30.29.30. 1 hit.
InterProIPR001589. Actinin_actin-bd_CS.
IPR001715. CH-domain.
IPR001605. PH_dom-spectrin-type.
IPR011993. PH_like_dom.
IPR001849. Pleckstrin_homology.
IPR018159. Spectrin/alpha-actinin.
IPR016343. Spectrin_bsu.
IPR002017. Spectrin_repeat.
[Graphical view]
PfamPF00307. CH. 2 hits.
PF00435. Spectrin. 14 hits.
[Graphical view]
PIRSFPIRSF002297. Spectrin_beta_subunit. 1 hit.
PRINTSPR00683. SPECTRINPH.
SMARTSM00033. CH. 2 hits.
SM00233. PH. 1 hit.
SM00150. SPEC. 16 hits.
[Graphical view]
SUPFAMSSF47576. SSF47576. 1 hit.
PROSITEPS00019. ACTININ_1. 1 hit.
PS00020. ACTININ_2. 1 hit.
PS50021. CH. 2 hits.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiSPTBN4.
GenomeRNAi57731.
NextBio64688.
PROQ9H254.
SOURCESearch...

Entry information

Entry nameSPTN4_HUMAN
AccessionPrimary (citable) accession number: Q9H254
Secondary accession number(s): E9PGQ5 expand/collapse secondary AC list , Q9H1K7, Q9H1K8, Q9H1K9, Q9H253, Q9H3G8, Q9HCD0
Entry history
Integrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: November 16, 2001
Last modified: July 9, 2014
This is version 128 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 19

Human chromosome 19: entries, gene names and cross-references to MIM