Q9H252 (KCNH6_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 102.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Potassium voltage-gated channel subfamily H member 6 Alternative name(s): Ether-a-go-go-related gene potassium channel 2 Short name=ERG-2 Short name=Eag-related protein 2 Short name=Ether-a-go-go-related protein 2 Short name=hERG-2 Short name=hERG2 Voltage-gated potassium channel subunit Kv11.2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 994 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Pore-forming (alpha) subunit of voltage-gated potassium channel. Elicits a slowly activating, rectifying current By similarity. Channel properties may be modulated by cAMP and subunit assembly. |
| Subunit structure | The potassium channel is probably composed of a homo- or heterotetrameric complex of pore-forming alpha subunits that can associate with modulating beta subunits. Heteromultimers with KCNH2/ERG1 and KCNH7/ERG3 By similarity. |
| Subcellular location | |
| Tissue specificity | Expressed in prolactin-secreting adenomas. Ref.4 |
| Domain | The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position. |
| Sequence similarities | Belongs to the potassium channel family. H (Eag) (TC 1.A.1.20) subfamily. Kv11.2/KCNH6 sub-subfamily. [View classification] Contains 1 cyclic nucleotide-binding domain. Contains 1 PAC (PAS-associated C-terminal) domain. Contains 1 PAS (PER-ARNT-SIM) domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ion transport Potassium transport Transport |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Ligand | Potassium |
| Molecular function | Ionic channel Potassium channel Voltage-gated channel |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | regulation of transcription, DNA-dependent Inferred from electronic annotation. Source: InterPro signal transductionInferred from electronic annotation. Source: InterPro synaptic transmissionTraceable author statement. Source: Reactome |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform 1 (identifier: Q9H252-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9H252-2) The sequence of this isoform differs from the canonical sequence as follows: 419-472: WYAIGNVERPYLEHKIGWLDSLGVQLGKRYNGSDPASGPSVQDKYVTALYFTFS → C 745-780: Missing. | ||||||
| Isoform 3 (identifier: Q9H252-3) The sequence of this isoform differs from the canonical sequence as follows: 501-502: SL → CE 503-994: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 994 | 994 | Potassium voltage-gated channel subfamily H member 6 | PRO_0000054013 | |||||
Regions | |||||||||
| Topological domain | 1 – 261 | 261 | Cytoplasmic Potential | ||||||
| Transmembrane | 262 – 282 | 21 | Helical; Name=Segment S1; Potential | ||||||
| Topological domain | 283 – 298 | 16 | Extracellular Potential | ||||||
| Transmembrane | 299 – 319 | 21 | Helical; Name=Segment S2; Potential | ||||||
| Topological domain | 320 – 340 | 21 | Cytoplasmic Potential | ||||||
| Transmembrane | 341 – 361 | 21 | Helical; Name=Segment S3; Potential | ||||||
| Topological domain | 362 – 370 | 9 | Extracellular Potential | ||||||
| Transmembrane | 371 – 391 | 21 | Helical; Voltage-sensor; Name=Segment S4; Potential | ||||||
| Topological domain | 392 – 398 | 7 | Cytoplasmic Potential | ||||||
| Transmembrane | 399 – 419 | 21 | Helical; Name=Segment S5; Potential | ||||||
| Topological domain | 420 – 463 | 44 | Extracellular Potential | ||||||
| Intramembrane | 464 – 484 | 21 | Pore-forming; Name=Segment H5; Potential | ||||||
| Topological domain | 485 – 490 | 6 | Extracellular Potential | ||||||
| Transmembrane | 491 – 511 | 21 | Helical; Name=Segment S6; Potential | ||||||
| Topological domain | 512 – 994 | 483 | Cytoplasmic Potential | ||||||
| Domain | 41 – 70 | 30 | PAS | ||||||
| Domain | 92 – 144 | 53 | PAC | ||||||
| Nucleotide binding | 594 – 711 | 118 | cNMP | ||||||
| Motif | 476 – 481 | 6 | Selectivity filter By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 419 – 472 | 54 | WYAIG…YFTFS → C in isoform 2. | VSP_000977 | |||||
| Alternative sequence | 501 – 502 | 2 | SL → CE in isoform 3. | VSP_000979 | |||||
| Alternative sequence | 503 – 994 | 492 | Missing in isoform 3. | VSP_000980 | |||||
| Alternative sequence | 745 – 780 | 36 | Missing in isoform 2. | VSP_000978 | |||||
| Natural variant | 165 | 1 | G → R. Corresponds to variant rs35399062 [ dbSNP | Ensembl ]. | VAR_053857 | |||||
| Natural variant | 925 | 1 | T → M. Ref.2 Corresponds to variant rs35819807 [ dbSNP | Ensembl ]. | VAR_053858 | |||||
Experimental info | |||||||||
| Sequence conflict | 963 | 1 | F → L in BAC03764. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human Eag-related gene member 2 (Herg2) potassium channel." Titus S.A., Ganetzky B.S. Submitted (OCT-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT MET-925. Tissue: Amygdala and Kidney. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Uterus. |
| [4] | "HERG K(+) currents in human prolactin-secreting adenoma cells." Bauer C.K., Wulfsen I., Schaefer R., Glassmeier G., Wimmers S., Flitsch J., Luedecke D.K., Schwarz J.R. Pflugers Arch. 445:589-600(2003) [PubMed: 12634931] [Abstract] Cited for: TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF311913 mRNA. Translation: AAG40871.1. AK090969 mRNA. Translation: BAC03559.1. AK091877 mRNA. Translation: BAC03764.1. BC006334 mRNA. Translation: AAH06334.1. |
| IPI | IPI00006515. IPI00216624. IPI00216625. |
| RefSeq | NP_110406.1. NM_030779.2. NP_775115.1. NM_173092.1. |
| UniGene | Hs.591177. |
3D structure databases | |
| ProteinModelPortal | Q9H252. |
| SMR | Q9H252. Positions 1-130, 463-516, 519-707. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9H252. |
Polymorphism databases | |
| DMDM | 26006810. |
Proteomic databases | |
| PRIDE | Q9H252. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000314672; ENSP00000318212; ENSG00000173826. ENST00000392968; ENSP00000376695; ENSG00000173826. |
| GeneID | 81033. |
| KEGG | hsa:81033. |
| UCSC | uc002jax.1. human. uc002jay.1. human. uc002jaz.1. human. |
Organism-specific databases | |
| CTD | 81033. |
| GeneCards | GC17P061600. |
| H-InvDB | HIX0202448. |
| HGNC | HGNC:18862. KCNH6. |
| HPA | CAB006838. CAB022674. |
| MIM | 608168. gene. |
| neXtProt | NX_Q9H252. |
| PharmGKB | PA38722. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG16315. |
| GeneTree | ENSGT00550000074394. |
| HOGENOM | HBG717083. |
| HOVERGEN | HBG052232. |
| InParanoid | Q9H252. |
| OMA | HGSDPGF. |
| PhylomeDB | Q9H252. |
Enzyme and pathway databases | |
| Reactome | REACT_13685. Neuronal System. |
Gene expression databases | |
| ArrayExpress | Q9H252. |
| Bgee | Q9H252. |
| CleanEx | HS_KCNH6. |
| Genevestigator | Q9H252. |
| GermOnline | ENSG00000173826. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR018490. cNMP-bd-like. IPR000595. cNMP-bd_dom. IPR005821. Ion_trans. IPR003938. K_chnl_volt-dep_EAG/ELK/ERG. IPR003967. K_chnl_volt-dep_ERG. IPR001610. PAC. IPR013767. PAS_fold. IPR014710. RmlC-like_jellyroll. [Graphical view] |
| Gene3D | G3DSA:2.60.120.10. RmlC-like_jellyroll. 2 hits. |
| KO | K04909. |
| Pfam | PF00027. cNMP_binding. 1 hit. PF00520. Ion_trans. 1 hit. PF00989. PAS. 1 hit. [Graphical view] |
| PRINTS | PR01463. EAGCHANLFMLY. PR01470. ERGCHANNEL. |
| SMART | SM00100. cNMP. 1 hit. SM00086. PAC. 1 hit. [Graphical view] |
| SUPFAM | SSF51206. cNMP_binding. 1 hit. |
| PROSITE | PS00888. CNMP_BINDING_1. False negative. PS00889. CNMP_BINDING_2. False negative. PS50042. CNMP_BINDING_3. 1 hit. PS50113. PAC. False negative. PS50112. PAS. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| DrugBank | DB00308. Ibutilide. |
| NextBio | 71366. |
| SOURCE | Search... |
Entry information
| Entry name | KCNH6_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H252 Secondary accession number(s): Q9BRD7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with