SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9H165

- BC11A_HUMAN

UniProt

Q9H165 - BC11A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
B-cell lymphoma/leukemia 11A
Gene
BCL11A, CTIP1, EVI9, KIAA1809, ZNF856
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Functions as a myeloid and B-cell proto-oncogene. May play important roles in leukemogenesis and hematopoiesis. An essential factor in lymphopoiesis, is required for B-cell formation in fetal liver. May function as a modulator of the transcriptional repression activity of ARP1 By similarity.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri170 – 19324C2H2-type 1
Add
BLAST
Zinc fingeri377 – 39923C2H2-type 2
Add
BLAST
Zinc fingeri405 – 42925C2H2-type 3
Add
BLAST
Zinc fingeri742 – 76423C2H2-type 4
Add
BLAST
Zinc fingeri770 – 79223C2H2-type 5
Add
BLAST
Zinc fingeri800 – 82324C2H2-type 6
Add
BLAST

GO - Molecular functioni

  1. metal ion binding Source: UniProtKB-KW
  2. nucleic acid binding Source: InterPro
  3. protein heterodimerization activity Source: BHF-UCL
  4. protein homodimerization activity Source: BHF-UCL
  5. transcription corepressor activity Source: Ensembl

GO - Biological processi

  1. B cell differentiation Source: Ensembl
  2. T cell differentiation Source: Ensembl
  3. negative regulation of axon extension Source: BHF-UCL
  4. negative regulation of collateral sprouting Source: BHF-UCL
  5. negative regulation of dendrite development Source: BHF-UCL
  6. negative regulation of gene expression Source: Ensembl
  7. negative regulation of neuron projection development Source: BHF-UCL
  8. negative regulation of protein homooligomerization Source: BHF-UCL
  9. positive regulation of collateral sprouting Source: BHF-UCL
  10. positive regulation of neuron projection development Source: BHF-UCL
  11. positive regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
  12. protein sumoylation Source: UniProtKB
  13. regulation of dendrite development Source: BHF-UCL
  14. regulation of transcription, DNA-templated Source: UniProtKB-KW
  15. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
B-cell lymphoma/leukemia 11A
Short name:
BCL-11A
Alternative name(s):
B-cell CLL/lymphoma 11A
COUP-TF-interacting protein 1
Ecotropic viral integration site 9 protein homolog
Short name:
EVI-9
Zinc finger protein 856
Gene namesi
Name:BCL11A
Synonyms:CTIP1, EVI9, KIAA1809, ZNF856
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:13221. BCL11A.

Subcellular locationi

Cytoplasm. Nucleus
Note: Associates with the nuclear body. Colocalizes with SUMO1 and SENP2 in nuclear speckles By similarity.1 Publication

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell
  2. nucleus Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Involvement in diseasei

Chromosomal aberrations involving BCL11A may be a cause of lymphoid malignancies. Translocation t(2;14)(p13;q32.3) causes BCL11A deregulation and amplification.

Organism-specific databases

MIMi142335. phenotype.
Orphaneti46532. Hereditary persistence of fetal hemoglobin - beta-thalassemia.
PharmGKBiPA25300.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 835835B-cell lymphoma/leukemia 11A
PRO_0000047102Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei205 – 2051Phosphoserine1 Publication
Modified residuei332 – 3321Phosphoserine1 Publication
Modified residuei608 – 6081Phosphoserine1 Publication
Modified residuei625 – 6251Phosphoserine1 Publication
Modified residuei630 – 6301Phosphoserine1 Publication
Cross-linki634 – 634Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO-1) By similarity
Modified residuei701 – 7011Phosphothreonine1 Publication

Post-translational modificationi

Sumoylated with SUMO1 By similarity.

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ9H165.
PaxDbiQ9H165.
PRIDEiQ9H165.

PTM databases

PhosphoSiteiQ9H165.

Expressioni

Tissue specificityi

Expressed at high levels in brain, spleen thymus, bone marrow and testis. Expressed in CD34-positive myeloid precursor cells, B-cells, monocytes and megakaryocytes. Expression is tightly regulated during B-cell development.2 Publications

Gene expression databases

ArrayExpressiQ9H165.
BgeeiQ9H165.
CleanExiHS_BCL11A.
GenevestigatoriQ9H165.

Organism-specific databases

HPAiCAB014891.
HPA029003.

Interactioni

Subunit structurei

Interacts with TFCOUP1, PIAS3, ARP1 and EAR2 By similarity.

Protein-protein interaction databases

BioGridi119737. 22 interactions.
IntActiQ9H165. 9 interactions.
STRINGi9606.ENSP00000338774.

Structurei

3D structure databases

ProteinModelPortaliQ9H165.
SMRiQ9H165. Positions 165-202, 338-460, 706-827.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 210210Required for nuclear body formation and for SUMO1 recruitment By similarity
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi260 – 373114Pro-rich
Add
BLAST
Compositional biasi481 – 50929Glu-rich
Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiNOG271772.
HOVERGENiHBG050673.
InParanoidiQ9H165.
OMAiMIPENGD.
OrthoDBiEOG7MH0XP.
PhylomeDBiQ9H165.
TreeFamiTF318131.

Family and domain databases

Gene3Di3.30.160.60. 4 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00096. zf-C2H2. 1 hit.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 6 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 6 hits.
PS50157. ZINC_FINGER_C2H2_2. 6 hits.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9H165-1) [UniParc]FASTAAdd to Basket

Also known as: BCL11A-XL, BCL11A extra long form

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSRRKQGKPQ HLSKREFSPE PLEAILTDDE PDHGPLGAPE GDHDLLTCGQ    50
CQMNFPLGDI LIFIEHKRKQ CNGSLCLEKA VDKPPSPSPI EMKKASNPVE 100
VGIQVTPEDD DCLSTSSRGI CPKQEHIADK LLHWRGLSSP RSAHGALIPT 150
PGMSAEYAPQ GICKDEPSSY TCTTCKQPFT SAWFLLQHAQ NTHGLRIYLE 200
SEHGSPLTPR VGIPSGLGAE CPSQPPLHGI HIADNNPFNL LRIPGSVSRE 250
ASGLAEGRFP PTPPLFSPPP RHHLDPHRIE RLGAEEMALA THHPSAFDRV 300
LRLNPMAMEP PAMDFSRRLR ELAGNTSSPP LSPGRPSPMQ RLLQPFQPGS 350
KPPFLATPPL PPLQSAPPPS QPPVKSKSCE FCGKTFKFQS NLVVHRRSHT 400
GEKPYKCNLC DHACTQASKL KRHMKTHMHK SSPMTVKSDD GLSTASSPEP 450
GTSDLVGSAS SALKSVVAKF KSENDPNLIP ENGDEEEEED DEEEEEEEEE 500
EEEELTESER VDYGFGLSLE AARHHENSSR GAVVGVGDES RALPDVMQGM 550
VLSSMQHFSE AFHQVLGEKH KRGHLAEAEG HRDTCDEDSV AGESDRIDDG 600
TVNGRGCSPG ESASGGLSKK LLLGSPSSLS PFSKRIKLEK EFDLPPAAMP 650
NTENVYSQWL AGYAASRQLK DPFLSFGDSR QSPFASSSEH SSENGSLRFS 700
TPPGELDGGI SGRSGTGSGG STPHISGPGP GRPSSKEGRR SDTCEYCGKV 750
FKNCSNLTVH RRSHTGERPY KCELCNYACA QSSKLTRHMK THGQVGKDVY 800
KCEICKMPFS VYSTLEKHMK KWHSDRVLNN DIKTE 835
Length:835
Mass (Da):91,197
Last modified:March 1, 2004 - v2
Checksum:iD36A7D0BE6976DCF
GO
Isoform 2 (identifier: Q9H165-2) [UniParc]FASTAAdd to Basket

Also known as: BCL11A-L, BCL11A long form

The sequence of this isoform differs from the canonical sequence as follows:
     745-773: EYCGKVFKNCSNLTVHRRSHTGERPYKCE → SSHTPIRRSTQRAQDVWQFSDGSSRALKF
     774-835: Missing.

Show »
Length:773
Mass (Da):83,860
Checksum:i251E8A1F3EB87956
GO
Isoform 3 (identifier: Q9H165-3) [UniParc]FASTAAdd to Basket

Also known as: BCL11A-S, BCL11A short form

The sequence of this isoform differs from the canonical sequence as follows:
     212-243: GIPSGLGAECPSQPPLHGIHIADNNPFNLLRI → LHTPPFGVVPRELKMCGSFRMEAREPLSSEKI
     244-835: Missing.

Show »
Length:243
Mass (Da):26,866
Checksum:i5B24FE61F3831226
GO
Isoform 4 (identifier: Q9H165-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKGTDEDIFSGVSFFLTRLSRCEPSRRPPAPQPT
     522-532: Missing.
     745-773: EYCGKVFKNCSNLTVHRRSHTGERPYKCE → SSHTPIRRSTQRAQDVWQFSDGSSRALKF
     774-835: Missing.

Show »
Length:796
Mass (Da):86,419
Checksum:iDE7726EEECF40070
GO
Isoform 5 (identifier: Q9H165-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKGTDEDIFSGVSFFLTRLSRCEPSRRPPAPQPT
     211-239: VGIPSGLGAECPSQPPLHGIHIADNNPFN → CSSHTPIRRSTQRAQDVWQFSDGSRALKF
     240-835: Missing.

Show »
Length:273
Mass (Da):30,251
Checksum:i901EB02453006AF7
GO
Isoform 6 (identifier: Q9H165-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     129-163: DKLLHWRGLSSPRSAHGALIPTPGMSAEYAPQGIC → G

Show »
Length:801
Mass (Da):87,554
Checksum:i3DFB3B3A0798B567
GO

Sequence cautioni

The sequence BAB47438.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Polymorphismi

Genetic variation in BCL11A underlies the fetal hemoglobin quantitative trait locus 5 [MIMi:142335]. It is associated with quantitative variation in the production of F cells, that is erythrocytes containing measurable amounts of fetal hemoglobin (HbF). In healthy adults, HbF is present at residual levels (less than 0.6% of total hemoglobin) with over twenty-fold variation. Ten to fifteen percent of adults in the upper tail of the distribution have HbF levels between 0.8% and 5.0%, a condition referred to as heterocellular hereditary persistence of fetal hemoglobin (hHPFH). Although these HbF levels are modest in otherwise healthy individuals, interaction of hHPFH with beta thalassemia or sickle cell disease can increase HbF output in these individuals to levels that are clinically beneficial.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti142 – 1421S → F in a breast cancer sample; somatic mutation. 1 Publication
VAR_035553

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MSKGTDEDIFSGVSFFLTRL SRCEPSRRPPAPQPT in isoform 4 and isoform 5.
VSP_009547
Alternative sequencei129 – 16335DKLLH…PQGIC → G in isoform 6.
VSP_009548Add
BLAST
Alternative sequencei211 – 23929VGIPS…NNPFN → CSSHTPIRRSTQRAQDVWQF SDGSRALKF in isoform 5.
VSP_009549Add
BLAST
Alternative sequencei212 – 24332GIPSG…NLLRI → LHTPPFGVVPRELKMCGSFR MEAREPLSSEKI in isoform 3.
VSP_009550Add
BLAST
Alternative sequencei240 – 835596Missing in isoform 5.
VSP_009551Add
BLAST
Alternative sequencei244 – 835592Missing in isoform 3.
VSP_009552Add
BLAST
Alternative sequencei522 – 53211Missing in isoform 4.
VSP_009553Add
BLAST
Alternative sequencei745 – 77329EYCGK…PYKCE → SSHTPIRRSTQRAQDVWQFS DGSSRALKF in isoform 2 and isoform 4.
VSP_009554Add
BLAST
Alternative sequencei774 – 83562Missing in isoform 2 and isoform 4.
VSP_009555Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti119 – 1191G → R in CAC17723. 1 Publication
Sequence conflicti119 – 1191G → R in CAC17724. 1 Publication
Sequence conflicti119 – 1191G → R in CAC17725. 1 Publication
Sequence conflicti316 – 3161S → F in AAG49025. 1 Publication
Sequence conflicti386 – 3861F → L in AAG49025. 1 Publication
Sequence conflicti648 – 6481A → T in CAC17723. 1 Publication
Sequence conflicti648 – 6481A → T in CAC17724. 1 Publication
Sequence conflicti653 – 6531E → D in AAG49025. 1 Publication
Sequence conflicti730 – 7301P → T in CAC17723. 1 Publication
Sequence conflicti730 – 7301P → T in CAC17724. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF080216 mRNA. Translation: AAG49025.1.
AJ404611 mRNA. Translation: CAC17723.1.
AJ404612 mRNA. Translation: CAC17724.1.
AJ404613 mRNA. Translation: CAC17725.1.
AY228763 mRNA. Translation: AAO88272.1.
AB058712 mRNA. Translation: BAB47438.1. Different initiation.
CH471053 Genomic DNA. Translation: EAX00035.1.
CH471053 Genomic DNA. Translation: EAX00040.1.
CH471053 Genomic DNA. Translation: EAX00041.1.
BC021098 mRNA. Translation: AAH21098.1.
AK001035 mRNA. No translation available.
CCDSiCCDS1861.1. [Q9H165-2]
CCDS1862.1. [Q9H165-1]
CCDS46295.1. [Q9H165-3]
RefSeqiNP_060484.2. NM_018014.3. [Q9H165-2]
NP_075044.2. NM_022893.3. [Q9H165-1]
NP_612569.1. NM_138559.1. [Q9H165-3]
UniGeneiHs.370549.

Genome annotation databases

EnsembliENST00000335712; ENSP00000338774; ENSG00000119866. [Q9H165-1]
ENST00000356842; ENSP00000349300; ENSG00000119866. [Q9H165-2]
ENST00000358510; ENSP00000351307; ENSG00000119866. [Q9H165-6]
ENST00000359629; ENSP00000352648; ENSG00000119866. [Q9H165-3]
GeneIDi53335.
KEGGihsa:53335.
UCSCiuc002sac.3. human. [Q9H165-3]
uc002sad.1. human. [Q9H165-1]
uc002saf.1. human. [Q9H165-6]

Polymorphism databases

DMDMi44887724.

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF080216 mRNA. Translation: AAG49025.1 .
AJ404611 mRNA. Translation: CAC17723.1 .
AJ404612 mRNA. Translation: CAC17724.1 .
AJ404613 mRNA. Translation: CAC17725.1 .
AY228763 mRNA. Translation: AAO88272.1 .
AB058712 mRNA. Translation: BAB47438.1 . Different initiation.
CH471053 Genomic DNA. Translation: EAX00035.1 .
CH471053 Genomic DNA. Translation: EAX00040.1 .
CH471053 Genomic DNA. Translation: EAX00041.1 .
BC021098 mRNA. Translation: AAH21098.1 .
AK001035 mRNA. No translation available.
CCDSi CCDS1861.1. [Q9H165-2 ]
CCDS1862.1. [Q9H165-1 ]
CCDS46295.1. [Q9H165-3 ]
RefSeqi NP_060484.2. NM_018014.3. [Q9H165-2 ]
NP_075044.2. NM_022893.3. [Q9H165-1 ]
NP_612569.1. NM_138559.1. [Q9H165-3 ]
UniGenei Hs.370549.

3D structure databases

ProteinModelPortali Q9H165.
SMRi Q9H165. Positions 165-202, 338-460, 706-827.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119737. 22 interactions.
IntActi Q9H165. 9 interactions.
STRINGi 9606.ENSP00000338774.

PTM databases

PhosphoSitei Q9H165.

Polymorphism databases

DMDMi 44887724.

Proteomic databases

MaxQBi Q9H165.
PaxDbi Q9H165.
PRIDEi Q9H165.

Protocols and materials databases

DNASUi 53335.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000335712 ; ENSP00000338774 ; ENSG00000119866 . [Q9H165-1 ]
ENST00000356842 ; ENSP00000349300 ; ENSG00000119866 . [Q9H165-2 ]
ENST00000358510 ; ENSP00000351307 ; ENSG00000119866 . [Q9H165-6 ]
ENST00000359629 ; ENSP00000352648 ; ENSG00000119866 . [Q9H165-3 ]
GeneIDi 53335.
KEGGi hsa:53335.
UCSCi uc002sac.3. human. [Q9H165-3 ]
uc002sad.1. human. [Q9H165-1 ]
uc002saf.1. human. [Q9H165-6 ]

Organism-specific databases

CTDi 53335.
GeneCardsi GC02M060678.
HGNCi HGNC:13221. BCL11A.
HPAi CAB014891.
HPA029003.
MIMi 142335. phenotype.
606557. gene.
neXtProti NX_Q9H165.
Orphaneti 46532. Hereditary persistence of fetal hemoglobin - beta-thalassemia.
PharmGKBi PA25300.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG271772.
HOVERGENi HBG050673.
InParanoidi Q9H165.
OMAi MIPENGD.
OrthoDBi EOG7MH0XP.
PhylomeDBi Q9H165.
TreeFami TF318131.

Miscellaneous databases

ChiTaRSi BCL11A. human.
GeneWikii BCL11A.
GenomeRNAii 53335.
NextBioi 55950.
PROi Q9H165.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9H165.
Bgeei Q9H165.
CleanExi HS_BCL11A.
Genevestigatori Q9H165.

Family and domain databases

Gene3Di 3.30.160.60. 4 hits.
InterProi IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view ]
Pfami PF00096. zf-C2H2. 1 hit.
[Graphical view ]
SMARTi SM00355. ZnF_C2H2. 6 hits.
[Graphical view ]
PROSITEi PS00028. ZINC_FINGER_C2H2_1. 6 hits.
PS50157. ZINC_FINGER_C2H2_2. 6 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Human EVI9, a homologue of the mouse myeloid leukemia gene, is expressed in the hematopoietic progenitors and down-regulated during myeloid differentiation of HL60 cells."
    Saiki Y., Yamazaki Y., Yoshida M., Katoh O., Nakamura T.
    Genomics 70:387-391(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4 AND 5), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Fetal brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), TISSUE SPECIFICITY.
  3. "Identification of a new isoform for B-cell CLL/lymphoma 11A (BCL11A) gene."
    Suriyapperuma S.P., Sarfarazi M.
    Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6).
  4. "Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O.
    DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Lymph.
  7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 636-835.
    Tissue: Embryo.
  8. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-205 AND SER-608, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-332; SER-625; SER-630 AND THR-701, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  11. Cited for: VARIANT [LARGE SCALE ANALYSIS] PHE-142.
  12. "A QTL influencing F cell production maps to a gene encoding a zinc-finger protein on chromosome 2p15."
    Menzel S., Garner C., Gut I., Matsuda F., Yamaguchi M., Heath S., Foglio M., Zelenika D., Boland A., Rooks H., Best S., Spector T.D., Farrall M., Lathrop M., Thein S.L.
    Nat. Genet. 39:1197-1199(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: POLYMORPHISM, ASSOCIATION WITH FETAL HEMOGLOBIN QUANTITATIVE TRAIT LOCUS 5.

Entry informationi

Entry nameiBC11A_HUMAN
AccessioniPrimary (citable) accession number: Q9H165
Secondary accession number(s): D6W5D7
, Q86W14, Q8WU92, Q96JL6, Q9H163, Q9H164, Q9H3G9, Q9NWA7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 1, 2004
Last sequence update: March 1, 2004
Last modified: July 9, 2014
This is version 123 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi