Q9H165 (BC11A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 112.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: B-cell lymphoma/leukemia 11A Short name=BCL-11A Alternative name(s): B-cell CLL/lymphoma 11A COUP-TF-interacting protein 1 Ecotropic viral integration site 9 protein homolog Short name=EVI-9 Zinc finger protein 856 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 835 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Functions as a myeloid and B-cell proto-oncogene. May play important roles in leukemogenesis and hematopoiesis. An essential factor in lymphopoiesis, is required for B-cell formation in fetal liver. May function as a modulator of the transcriptional repression activity of ARP1 By similarity. |
| Subunit structure | Interacts with TFCOUP1, PIAS3, ARP1 and EAR2 By similarity. |
| Subcellular location | Cytoplasm. Nucleus. Note: Associates with the nuclear body. Colocalizes with SUMO1 and SENP2 in nuclear speckles By similarity. Ref.1 |
| Tissue specificity | Expressed at high levels in brain, spleen thymus, bone marrow and testis. Expressed in CD34-positive myeloid precursor cells, B-cells, monocytes and megakaryocytes. Expression is tightly regulated during B-cell development. Ref.1 Ref.2 |
| Post-translational modification | Sumoylated with SUMO1 By similarity. |
| Polymorphism | Genetic variation in BCL11A underlies the fetal hemoglobin quantitative trait locus 5 [MIM:142335]. It is associated with quantitative variation in the production of F cells, that is erythrocytes containing measurable amounts of fetal hemoglobin (HbF). In healthy adults, HbF is present at residual levels (less than 0.6% of total hemoglobin) with over twenty-fold variation. Ten to fifteen percent of adults in the upper tail of the distribution have HbF levels between 0.8% and 5.0%, a condition referred to as heterocellular hereditary persistence of fetal hemoglobin (hHPFH). Although these HbF levels are modest in otherwise healthy individuals, interaction of hHPFH with beta thalassemia or sickle cell disease can increase HbF output in these individuals to levels that are clinically beneficial. |
| Involvement in disease | Chromosomal aberrations involving BCL11A may be a cause of lymphoid malignancies. Translocation t(2;14)(p13;q32.3) causes BCL11A deregulation and amplification. |
| Sequence similarities | Contains 6 C2H2-type zinc fingers. |
| Sequence caution | The sequence BAB47438.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9H165-1) Also known as: BCL11A-XL; BCL11A extra long form; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9H165-2) Also known as: BCL11A-L; BCL11A long form; The sequence of this isoform differs from the canonical sequence as follows: 745-773: EYCGKVFKNCSNLTVHRRSHTGERPYKCE → SSHTPIRRSTQRAQDVWQFSDGSSRALKF 774-835: Missing. | ||||||
| Isoform 3 (identifier: Q9H165-3) Also known as: BCL11A-S; BCL11A short form; The sequence of this isoform differs from the canonical sequence as follows: 212-243: GIPSGLGAECPSQPPLHGIHIADNNPFNLLRI → LHTPPFGVVPRELKMCGSFRMEAREPLSSEKI 244-835: Missing. | ||||||
| Isoform 4 (identifier: Q9H165-4) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MSKGTDEDIFSGVSFFLTRLSRCEPSRRPPAPQPT 522-532: Missing. 745-773: EYCGKVFKNCSNLTVHRRSHTGERPYKCE → SSHTPIRRSTQRAQDVWQFSDGSSRALKF 774-835: Missing. | ||||||
| Isoform 5 (identifier: Q9H165-5) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MSKGTDEDIFSGVSFFLTRLSRCEPSRRPPAPQPT 211-239: VGIPSGLGAECPSQPPLHGIHIADNNPFN → CSSHTPIRRSTQRAQDVWQFSDGSRALKF 240-835: Missing. | ||||||
| Isoform 6 (identifier: Q9H165-6) The sequence of this isoform differs from the canonical sequence as follows: 129-163: DKLLHWRGLSSPRSAHGALIPTPGMSAEYAPQGIC → G |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 835 | 835 | B-cell lymphoma/leukemia 11A | PRO_0000047102 | |||||
Regions | |||||||||
| Zinc finger | 170 – 193 | 24 | C2H2-type 1 | ||||||
| Zinc finger | 377 – 399 | 23 | C2H2-type 2 | ||||||
| Zinc finger | 405 – 429 | 25 | C2H2-type 3 | ||||||
| Zinc finger | 742 – 764 | 23 | C2H2-type 4 | ||||||
| Zinc finger | 770 – 792 | 23 | C2H2-type 5 | ||||||
| Zinc finger | 800 – 823 | 24 | C2H2-type 6 | ||||||
| Region | 1 – 210 | 210 | Required for nuclear body formation and for SUMO1 recruitment By similarity | ||||||
| Compositional bias | 260 – 373 | 114 | Pro-rich | ||||||
| Compositional bias | 481 – 509 | 29 | Glu-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 205 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 332 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 608 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 625 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 630 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 701 | 1 | Phosphothreonine Ref.9 | ||||||
| Cross-link | 634 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO-1) By similarity | |||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MSKGTDEDIFSGVSFFLTRL SRCEPSRRPPAPQPT in isoform 4 and isoform 5. | VSP_009547 | |||||
| Alternative sequence | 129 – 163 | 35 | DKLLH…PQGIC → G in isoform 6. | VSP_009548 | |||||
| Alternative sequence | 211 – 239 | 29 | VGIPS…NNPFN → CSSHTPIRRSTQRAQDVWQF SDGSRALKF in isoform 5. | VSP_009549 | |||||
| Alternative sequence | 212 – 243 | 32 | GIPSG…NLLRI → LHTPPFGVVPRELKMCGSFR MEAREPLSSEKI in isoform 3. | VSP_009550 | |||||
| Alternative sequence | 240 – 835 | 596 | Missing in isoform 5. | VSP_009551 | |||||
| Alternative sequence | 244 – 835 | 592 | Missing in isoform 3. | VSP_009552 | |||||
| Alternative sequence | 522 – 532 | 11 | Missing in isoform 4. | VSP_009553 | |||||
| Alternative sequence | 745 – 773 | 29 | EYCGK…PYKCE → SSHTPIRRSTQRAQDVWQFS DGSSRALKF in isoform 2 and isoform 4. | VSP_009554 | |||||
| Alternative sequence | 774 – 835 | 62 | Missing in isoform 2 and isoform 4. | VSP_009555 | |||||
| Natural variant | 142 | 1 | S → F in a breast cancer sample; somatic mutation. Ref.10 | VAR_035553 | |||||
Experimental info | |||||||||
| Sequence conflict | 119 | 1 | G → R in CAC17723. Ref.2 | ||||||
| Sequence conflict | 119 | 1 | G → R in CAC17724. Ref.2 | ||||||
| Sequence conflict | 119 | 1 | G → R in CAC17725. Ref.2 | ||||||
| Sequence conflict | 316 | 1 | S → F in AAG49025. Ref.1 | ||||||
| Sequence conflict | 386 | 1 | F → L in AAG49025. Ref.1 | ||||||
| Sequence conflict | 648 | 1 | A → T in CAC17723. Ref.2 | ||||||
| Sequence conflict | 648 | 1 | A → T in CAC17724. Ref.2 | ||||||
| Sequence conflict | 653 | 1 | E → D in AAG49025. Ref.1 | ||||||
| Sequence conflict | 730 | 1 | P → T in CAC17723. Ref.2 | ||||||
| Sequence conflict | 730 | 1 | P → T in CAC17724. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human EVI9, a homologue of the mouse myeloid leukemia gene, is expressed in the hematopoietic progenitors and down-regulated during myeloid differentiation of HL60 cells." Saiki Y., Yamazaki Y., Yoshida M., Katoh O., Nakamura T. Genomics 70:387-391(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4 AND 5), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Fetal brain. |
| [2] | "The BCL11 gene family: involvement of BCL11A in lymphoid malignancies." Satterwhite E., Sonoki T., Willis T.G., Harder L., Nowak R., Arriola E.L., Liu H., Price H.P., Gesk S., Steinemann D., Schlegelberger B., Oscier D.G., Siebert R., Tucker P.W., Dyer M.J. Blood 98:3413-3420(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), TISSUE SPECIFICITY. |
| [3] | "Identification of a new isoform for B-cell CLL/lymphoma 11A (BCL11A) gene." Suriyapperuma S.P., Sarfarazi M. Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6). |
| [4] | "Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O. DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Lymph. |
| [7] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 636-835. Tissue: Embryo. |
| [8] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-205 AND SER-608, MASS SPECTROMETRY. |
| [9] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-332; SER-625; SER-630 AND THR-701, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [10] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] PHE-142. |
| [11] | "A QTL influencing F cell production maps to a gene encoding a zinc-finger protein on chromosome 2p15." Menzel S., Garner C., Gut I., Matsuda F., Yamaguchi M., Heath S., Foglio M., Zelenika D., Boland A., Rooks H., Best S., Spector T.D., Farrall M., Lathrop M., Thein S.L. Nat. Genet. 39:1197-1199(2007) [PubMed] [Europe PMC] [Abstract] Cited for: POLYMORPHISM, ASSOCIATION WITH FETAL HEMOGLOBIN QUANTITATIVE TRAIT LOCUS 5. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF080216 mRNA. Translation: AAG49025.1. AJ404611 mRNA. Translation: CAC17723.1. AJ404612 mRNA. Translation: CAC17724.1. AJ404613 mRNA. Translation: CAC17725.1. AY228763 mRNA. Translation: AAO88272.1. AB058712 mRNA. Translation: BAB47438.1. Different initiation. CH471053 Genomic DNA. Translation: EAX00035.1. CH471053 Genomic DNA. Translation: EAX00040.1. CH471053 Genomic DNA. Translation: EAX00041.1. BC021098 mRNA. Translation: AAH21098.1. AK001035 mRNA. No translation available. |
| IPI | IPI00300332. IPI00400867. IPI00400868. IPI00400869. IPI00400870. IPI00400871. |
| RefSeq | NP_060484.2. NM_018014.3. NP_075044.2. NM_022893.3. NP_612569.1. NM_138559.1. |
| UniGene | Hs.370549. |
3D structure databases | |
| ProteinModelPortal | Q9H165. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9H165. 7 interactions. |
| STRING | 9606.ENSP00000338774. |
PTM databases | |
| PhosphoSite | Q9H165. |
Polymorphism databases | |
| DMDM | 44887724. |
Proteomic databases | |
| PaxDb | Q9H165. |
| PRIDE | Q9H165. |
Protocols and materials databases | |
| DNASU | 53335. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000335712; ENSP00000338774; ENSG00000119866. ENST00000356842; ENSP00000349300; ENSG00000119866. ENST00000358510; ENSP00000351307; ENSG00000119866. ENST00000359629; ENSP00000352648; ENSG00000119866. |
| GeneID | 53335. |
| KEGG | hsa:53335. |
| UCSC | uc002sac.3. human. uc002sad.1. human. uc002saf.1. human. |
Organism-specific databases | |
| CTD | 53335. |
| GeneCards | GC02M060678. |
| HGNC | HGNC:13221. BCL11A. |
| HPA | CAB014891. |
| MIM | 142335. phenotype. 606557. gene. |
| neXtProt | NX_Q9H165. |
| Orphanet | 46532. Hereditary persistence of fetal hemoglobin - beta-thalassemia. |
| PharmGKB | PA25300. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG271772. |
| HOVERGEN | HBG050673. |
| InParanoid | Q9H165. |
| OMA | GEGRFPP. |
| OrthoDB | EOG45DWQ2. |
Gene expression databases | |
| ArrayExpress | Q9H165. |
| Bgee | Q9H165. |
| CleanEx | HS_BCL11A. |
| Genevestigator | Q9H165. |
| GermOnline | ENSG00000119866. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.160.60. 4 hits. |
| InterPro | IPR007087. Znf_C2H2. IPR015880. Znf_C2H2-like. IPR013087. Znf_C2H2/integrase_DNA-bd. [Graphical view] |
| Pfam | PF00096. zf-C2H2. 1 hit. [Graphical view] |
| SMART | SM00355. ZnF_C2H2. 6 hits. [Graphical view] |
| PROSITE | PS00028. ZINC_FINGER_C2H2_1. 6 hits. PS50157. ZINC_FINGER_C2H2_2. 6 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | BCL11A. human. |
| GenomeRNAi | 53335. |
| NextBio | 55950. |
| SOURCE | Search... |
Entry information
| Entry name | BC11A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H165 Secondary accession number(s): D6W5D7 Q9NWA7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
