Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9H165

- BC11A_HUMAN

UniProt

Q9H165 - BC11A_HUMAN

Protein

B-cell lymphoma/leukemia 11A

Gene

BCL11A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 124 (01 Oct 2014)
      Sequence version 2 (01 Mar 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Functions as a myeloid and B-cell proto-oncogene. May play important roles in leukemogenesis and hematopoiesis. An essential factor in lymphopoiesis, is required for B-cell formation in fetal liver. May function as a modulator of the transcriptional repression activity of ARP1 By similarity.By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri170 – 19324C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri377 – 39923C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri405 – 42925C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri742 – 76423C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri770 – 79223C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri800 – 82324C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. metal ion binding Source: UniProtKB-KW
    2. protein heterodimerization activity Source: BHF-UCL
    3. protein homodimerization activity Source: BHF-UCL
    4. RNA polymerase II core promoter proximal region sequence-specific DNA binding Source: NTNU_SB
    5. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription Source: NTNU_SB
    6. transcription corepressor activity Source: Ensembl

    GO - Biological processi

    1. B cell differentiation Source: Ensembl
    2. negative regulation of axon extension Source: BHF-UCL
    3. negative regulation of collateral sprouting Source: BHF-UCL
    4. negative regulation of dendrite development Source: BHF-UCL
    5. negative regulation of neuron projection development Source: BHF-UCL
    6. negative regulation of protein homooligomerization Source: BHF-UCL
    7. negative regulation of transcription from RNA polymerase II promoter Source: NTNU_SB
    8. positive regulation of collateral sprouting Source: BHF-UCL
    9. positive regulation of neuron projection development Source: BHF-UCL
    10. positive regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
    11. protein sumoylation Source: UniProtKB
    12. regulation of dendrite development Source: BHF-UCL
    13. T cell differentiation Source: Ensembl

    Keywords - Molecular functioni

    Repressor

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    B-cell lymphoma/leukemia 11A
    Short name:
    BCL-11A
    Alternative name(s):
    B-cell CLL/lymphoma 11A
    COUP-TF-interacting protein 1
    Ecotropic viral integration site 9 protein homolog
    Short name:
    EVI-9
    Zinc finger protein 856
    Gene namesi
    Name:BCL11A
    Synonyms:CTIP1, EVI9, KIAA1809, ZNF856
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:13221. BCL11A.

    Subcellular locationi

    Cytoplasm 1 Publication. Nucleus 1 Publication
    Note: Associates with the nuclear body. Colocalizes with SUMO1 and SENP2 in nuclear speckles By similarity.By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. nucleus Source: BHF-UCL

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Involvement in diseasei

    Chromosomal aberrations involving BCL11A may be a cause of lymphoid malignancies. Translocation t(2;14)(p13;q32.3) causes BCL11A deregulation and amplification.

    Organism-specific databases

    MIMi142335. phenotype.
    Orphaneti46532. Hereditary persistence of fetal hemoglobin - beta-thalassemia.
    PharmGKBiPA25300.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 835835B-cell lymphoma/leukemia 11APRO_0000047102Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei205 – 2051Phosphoserine1 Publication
    Modified residuei332 – 3321Phosphoserine1 Publication
    Modified residuei608 – 6081Phosphoserine1 Publication
    Modified residuei625 – 6251Phosphoserine1 Publication
    Modified residuei630 – 6301Phosphoserine1 Publication
    Cross-linki634 – 634Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO-1)By similarity
    Modified residuei701 – 7011Phosphothreonine1 Publication

    Post-translational modificationi

    Sumoylated with SUMO1.By similarity

    Keywords - PTMi

    Isopeptide bond, Phosphoprotein, Ubl conjugation

    Proteomic databases

    MaxQBiQ9H165.
    PaxDbiQ9H165.
    PRIDEiQ9H165.

    PTM databases

    PhosphoSiteiQ9H165.

    Expressioni

    Tissue specificityi

    Expressed at high levels in brain, spleen thymus, bone marrow and testis. Expressed in CD34-positive myeloid precursor cells, B-cells, monocytes and megakaryocytes. Expression is tightly regulated during B-cell development.2 Publications

    Gene expression databases

    ArrayExpressiQ9H165.
    BgeeiQ9H165.
    CleanExiHS_BCL11A.
    GenevestigatoriQ9H165.

    Organism-specific databases

    HPAiCAB014891.
    HPA029003.

    Interactioni

    Subunit structurei

    Interacts with TFCOUP1, PIAS3, ARP1 and EAR2.By similarity

    Protein-protein interaction databases

    BioGridi119737. 22 interactions.
    IntActiQ9H165. 9 interactions.
    STRINGi9606.ENSP00000338774.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9H165.
    SMRiQ9H165. Positions 165-202, 338-460, 706-827.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 210210Required for nuclear body formation and for SUMO1 recruitmentBy similarityAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi260 – 373114Pro-richAdd
    BLAST
    Compositional biasi481 – 50929Glu-richAdd
    BLAST

    Sequence similaritiesi

    Contains 6 C2H2-type zinc fingers.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri170 – 19324C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri377 – 39923C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri405 – 42925C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri742 – 76423C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri770 – 79223C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri800 – 82324C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG271772.
    HOVERGENiHBG050673.
    InParanoidiQ9H165.
    OMAiMIPENGD.
    OrthoDBiEOG7MH0XP.
    PhylomeDBiQ9H165.
    TreeFamiTF318131.

    Family and domain databases

    Gene3Di3.30.160.60. 4 hits.
    InterProiIPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view]
    PfamiPF00096. zf-C2H2. 1 hit.
    [Graphical view]
    SMARTiSM00355. ZnF_C2H2. 6 hits.
    [Graphical view]
    PROSITEiPS00028. ZINC_FINGER_C2H2_1. 6 hits.
    PS50157. ZINC_FINGER_C2H2_2. 6 hits.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9H165-1) [UniParc]FASTAAdd to Basket

    Also known as: BCL11A-XL, BCL11A extra long form

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSRRKQGKPQ HLSKREFSPE PLEAILTDDE PDHGPLGAPE GDHDLLTCGQ    50
    CQMNFPLGDI LIFIEHKRKQ CNGSLCLEKA VDKPPSPSPI EMKKASNPVE 100
    VGIQVTPEDD DCLSTSSRGI CPKQEHIADK LLHWRGLSSP RSAHGALIPT 150
    PGMSAEYAPQ GICKDEPSSY TCTTCKQPFT SAWFLLQHAQ NTHGLRIYLE 200
    SEHGSPLTPR VGIPSGLGAE CPSQPPLHGI HIADNNPFNL LRIPGSVSRE 250
    ASGLAEGRFP PTPPLFSPPP RHHLDPHRIE RLGAEEMALA THHPSAFDRV 300
    LRLNPMAMEP PAMDFSRRLR ELAGNTSSPP LSPGRPSPMQ RLLQPFQPGS 350
    KPPFLATPPL PPLQSAPPPS QPPVKSKSCE FCGKTFKFQS NLVVHRRSHT 400
    GEKPYKCNLC DHACTQASKL KRHMKTHMHK SSPMTVKSDD GLSTASSPEP 450
    GTSDLVGSAS SALKSVVAKF KSENDPNLIP ENGDEEEEED DEEEEEEEEE 500
    EEEELTESER VDYGFGLSLE AARHHENSSR GAVVGVGDES RALPDVMQGM 550
    VLSSMQHFSE AFHQVLGEKH KRGHLAEAEG HRDTCDEDSV AGESDRIDDG 600
    TVNGRGCSPG ESASGGLSKK LLLGSPSSLS PFSKRIKLEK EFDLPPAAMP 650
    NTENVYSQWL AGYAASRQLK DPFLSFGDSR QSPFASSSEH SSENGSLRFS 700
    TPPGELDGGI SGRSGTGSGG STPHISGPGP GRPSSKEGRR SDTCEYCGKV 750
    FKNCSNLTVH RRSHTGERPY KCELCNYACA QSSKLTRHMK THGQVGKDVY 800
    KCEICKMPFS VYSTLEKHMK KWHSDRVLNN DIKTE 835
    Length:835
    Mass (Da):91,197
    Last modified:March 1, 2004 - v2
    Checksum:iD36A7D0BE6976DCF
    GO
    Isoform 2 (identifier: Q9H165-2) [UniParc]FASTAAdd to Basket

    Also known as: BCL11A-L, BCL11A long form

    The sequence of this isoform differs from the canonical sequence as follows:
         745-773: EYCGKVFKNCSNLTVHRRSHTGERPYKCE → SSHTPIRRSTQRAQDVWQFSDGSSRALKF
         774-835: Missing.

    Show »
    Length:773
    Mass (Da):83,860
    Checksum:i251E8A1F3EB87956
    GO
    Isoform 3 (identifier: Q9H165-3) [UniParc]FASTAAdd to Basket

    Also known as: BCL11A-S, BCL11A short form

    The sequence of this isoform differs from the canonical sequence as follows:
         212-243: GIPSGLGAECPSQPPLHGIHIADNNPFNLLRI → LHTPPFGVVPRELKMCGSFRMEAREPLSSEKI
         244-835: Missing.

    Show »
    Length:243
    Mass (Da):26,866
    Checksum:i5B24FE61F3831226
    GO
    Isoform 4 (identifier: Q9H165-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MSKGTDEDIFSGVSFFLTRLSRCEPSRRPPAPQPT
         522-532: Missing.
         745-773: EYCGKVFKNCSNLTVHRRSHTGERPYKCE → SSHTPIRRSTQRAQDVWQFSDGSSRALKF
         774-835: Missing.

    Show »
    Length:796
    Mass (Da):86,419
    Checksum:iDE7726EEECF40070
    GO
    Isoform 5 (identifier: Q9H165-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MSKGTDEDIFSGVSFFLTRLSRCEPSRRPPAPQPT
         211-239: VGIPSGLGAECPSQPPLHGIHIADNNPFN → CSSHTPIRRSTQRAQDVWQFSDGSRALKF
         240-835: Missing.

    Show »
    Length:273
    Mass (Da):30,251
    Checksum:i901EB02453006AF7
    GO
    Isoform 6 (identifier: Q9H165-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         129-163: DKLLHWRGLSSPRSAHGALIPTPGMSAEYAPQGIC → G

    Show »
    Length:801
    Mass (Da):87,554
    Checksum:i3DFB3B3A0798B567
    GO

    Sequence cautioni

    The sequence BAB47438.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti119 – 1191G → R in CAC17723. (PubMed:11719382)Curated
    Sequence conflicti119 – 1191G → R in CAC17724. (PubMed:11719382)Curated
    Sequence conflicti119 – 1191G → R in CAC17725. (PubMed:11719382)Curated
    Sequence conflicti316 – 3161S → F in AAG49025. (PubMed:11161790)Curated
    Sequence conflicti386 – 3861F → L in AAG49025. (PubMed:11161790)Curated
    Sequence conflicti648 – 6481A → T in CAC17723. (PubMed:11719382)Curated
    Sequence conflicti648 – 6481A → T in CAC17724. (PubMed:11719382)Curated
    Sequence conflicti653 – 6531E → D in AAG49025. (PubMed:11161790)Curated
    Sequence conflicti730 – 7301P → T in CAC17723. (PubMed:11719382)Curated
    Sequence conflicti730 – 7301P → T in CAC17724. (PubMed:11719382)Curated

    Polymorphismi

    Genetic variation in BCL11A underlies the fetal hemoglobin quantitative trait locus 5 [MIMi:142335]. It is associated with quantitative variation in the production of F cells, that is erythrocytes containing measurable amounts of fetal hemoglobin (HbF). In healthy adults, HbF is present at residual levels (less than 0.6% of total hemoglobin) with over twenty-fold variation. Ten to fifteen percent of adults in the upper tail of the distribution have HbF levels between 0.8% and 5.0%, a condition referred to as heterocellular hereditary persistence of fetal hemoglobin (hHPFH). Although these HbF levels are modest in otherwise healthy individuals, interaction of hHPFH with beta thalassemia or sickle cell disease can increase HbF output in these individuals to levels that are clinically beneficial.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti142 – 1421S → F in a breast cancer sample; somatic mutation. 1 Publication
    VAR_035553

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MSKGTDEDIFSGVSFFLTRL SRCEPSRRPPAPQPT in isoform 4 and isoform 5. 1 PublicationVSP_009547
    Alternative sequencei129 – 16335DKLLH…PQGIC → G in isoform 6. 1 PublicationVSP_009548Add
    BLAST
    Alternative sequencei211 – 23929VGIPS…NNPFN → CSSHTPIRRSTQRAQDVWQF SDGSRALKF in isoform 5. 1 PublicationVSP_009549Add
    BLAST
    Alternative sequencei212 – 24332GIPSG…NLLRI → LHTPPFGVVPRELKMCGSFR MEAREPLSSEKI in isoform 3. 1 PublicationVSP_009550Add
    BLAST
    Alternative sequencei240 – 835596Missing in isoform 5. 1 PublicationVSP_009551Add
    BLAST
    Alternative sequencei244 – 835592Missing in isoform 3. 1 PublicationVSP_009552Add
    BLAST
    Alternative sequencei522 – 53211Missing in isoform 4. 1 PublicationVSP_009553Add
    BLAST
    Alternative sequencei745 – 77329EYCGK…PYKCE → SSHTPIRRSTQRAQDVWQFS DGSSRALKF in isoform 2 and isoform 4. 4 PublicationsVSP_009554Add
    BLAST
    Alternative sequencei774 – 83562Missing in isoform 2 and isoform 4. 4 PublicationsVSP_009555Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF080216 mRNA. Translation: AAG49025.1.
    AJ404611 mRNA. Translation: CAC17723.1.
    AJ404612 mRNA. Translation: CAC17724.1.
    AJ404613 mRNA. Translation: CAC17725.1.
    AY228763 mRNA. Translation: AAO88272.1.
    AB058712 mRNA. Translation: BAB47438.1. Different initiation.
    CH471053 Genomic DNA. Translation: EAX00035.1.
    CH471053 Genomic DNA. Translation: EAX00040.1.
    CH471053 Genomic DNA. Translation: EAX00041.1.
    BC021098 mRNA. Translation: AAH21098.1.
    AK001035 mRNA. No translation available.
    CCDSiCCDS1861.1. [Q9H165-2]
    CCDS1862.1. [Q9H165-1]
    CCDS46295.1. [Q9H165-3]
    RefSeqiNP_060484.2. NM_018014.3. [Q9H165-2]
    NP_075044.2. NM_022893.3. [Q9H165-1]
    NP_612569.1. NM_138559.1. [Q9H165-3]
    UniGeneiHs.370549.

    Genome annotation databases

    EnsembliENST00000335712; ENSP00000338774; ENSG00000119866. [Q9H165-1]
    ENST00000356842; ENSP00000349300; ENSG00000119866. [Q9H165-2]
    ENST00000358510; ENSP00000351307; ENSG00000119866. [Q9H165-6]
    ENST00000359629; ENSP00000352648; ENSG00000119866. [Q9H165-3]
    GeneIDi53335.
    KEGGihsa:53335.
    UCSCiuc002sac.3. human. [Q9H165-3]
    uc002sad.1. human. [Q9H165-1]
    uc002saf.1. human. [Q9H165-6]

    Polymorphism databases

    DMDMi44887724.

    Keywords - Coding sequence diversityi

    Alternative splicing, Chromosomal rearrangement, Polymorphism

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF080216 mRNA. Translation: AAG49025.1 .
    AJ404611 mRNA. Translation: CAC17723.1 .
    AJ404612 mRNA. Translation: CAC17724.1 .
    AJ404613 mRNA. Translation: CAC17725.1 .
    AY228763 mRNA. Translation: AAO88272.1 .
    AB058712 mRNA. Translation: BAB47438.1 . Different initiation.
    CH471053 Genomic DNA. Translation: EAX00035.1 .
    CH471053 Genomic DNA. Translation: EAX00040.1 .
    CH471053 Genomic DNA. Translation: EAX00041.1 .
    BC021098 mRNA. Translation: AAH21098.1 .
    AK001035 mRNA. No translation available.
    CCDSi CCDS1861.1. [Q9H165-2 ]
    CCDS1862.1. [Q9H165-1 ]
    CCDS46295.1. [Q9H165-3 ]
    RefSeqi NP_060484.2. NM_018014.3. [Q9H165-2 ]
    NP_075044.2. NM_022893.3. [Q9H165-1 ]
    NP_612569.1. NM_138559.1. [Q9H165-3 ]
    UniGenei Hs.370549.

    3D structure databases

    ProteinModelPortali Q9H165.
    SMRi Q9H165. Positions 165-202, 338-460, 706-827.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 119737. 22 interactions.
    IntActi Q9H165. 9 interactions.
    STRINGi 9606.ENSP00000338774.

    PTM databases

    PhosphoSitei Q9H165.

    Polymorphism databases

    DMDMi 44887724.

    Proteomic databases

    MaxQBi Q9H165.
    PaxDbi Q9H165.
    PRIDEi Q9H165.

    Protocols and materials databases

    DNASUi 53335.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000335712 ; ENSP00000338774 ; ENSG00000119866 . [Q9H165-1 ]
    ENST00000356842 ; ENSP00000349300 ; ENSG00000119866 . [Q9H165-2 ]
    ENST00000358510 ; ENSP00000351307 ; ENSG00000119866 . [Q9H165-6 ]
    ENST00000359629 ; ENSP00000352648 ; ENSG00000119866 . [Q9H165-3 ]
    GeneIDi 53335.
    KEGGi hsa:53335.
    UCSCi uc002sac.3. human. [Q9H165-3 ]
    uc002sad.1. human. [Q9H165-1 ]
    uc002saf.1. human. [Q9H165-6 ]

    Organism-specific databases

    CTDi 53335.
    GeneCardsi GC02M060678.
    HGNCi HGNC:13221. BCL11A.
    HPAi CAB014891.
    HPA029003.
    MIMi 142335. phenotype.
    606557. gene.
    neXtProti NX_Q9H165.
    Orphaneti 46532. Hereditary persistence of fetal hemoglobin - beta-thalassemia.
    PharmGKBi PA25300.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG271772.
    HOVERGENi HBG050673.
    InParanoidi Q9H165.
    OMAi MIPENGD.
    OrthoDBi EOG7MH0XP.
    PhylomeDBi Q9H165.
    TreeFami TF318131.

    Miscellaneous databases

    ChiTaRSi BCL11A. human.
    GeneWikii BCL11A.
    GenomeRNAii 53335.
    NextBioi 55950.
    PROi Q9H165.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9H165.
    Bgeei Q9H165.
    CleanExi HS_BCL11A.
    Genevestigatori Q9H165.

    Family and domain databases

    Gene3Di 3.30.160.60. 4 hits.
    InterProi IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view ]
    Pfami PF00096. zf-C2H2. 1 hit.
    [Graphical view ]
    SMARTi SM00355. ZnF_C2H2. 6 hits.
    [Graphical view ]
    PROSITEi PS00028. ZINC_FINGER_C2H2_1. 6 hits.
    PS50157. ZINC_FINGER_C2H2_2. 6 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Human EVI9, a homologue of the mouse myeloid leukemia gene, is expressed in the hematopoietic progenitors and down-regulated during myeloid differentiation of HL60 cells."
      Saiki Y., Yamazaki Y., Yoshida M., Katoh O., Nakamura T.
      Genomics 70:387-391(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4 AND 5), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
      Tissue: Fetal brain.
    2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), TISSUE SPECIFICITY.
    3. "Identification of a new isoform for B-cell CLL/lymphoma 11A (BCL11A) gene."
      Suriyapperuma S.P., Sarfarazi M.
      Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6).
    4. "Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O.
      DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Lymph.
    7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 636-835.
      Tissue: Embryo.
    8. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-205 AND SER-608, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    10. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-332; SER-625; SER-630 AND THR-701, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    11. Cited for: VARIANT [LARGE SCALE ANALYSIS] PHE-142.
    12. "A QTL influencing F cell production maps to a gene encoding a zinc-finger protein on chromosome 2p15."
      Menzel S., Garner C., Gut I., Matsuda F., Yamaguchi M., Heath S., Foglio M., Zelenika D., Boland A., Rooks H., Best S., Spector T.D., Farrall M., Lathrop M., Thein S.L.
      Nat. Genet. 39:1197-1199(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: POLYMORPHISM, ASSOCIATION WITH FETAL HEMOGLOBIN QUANTITATIVE TRAIT LOCUS 5.

    Entry informationi

    Entry nameiBC11A_HUMAN
    AccessioniPrimary (citable) accession number: Q9H165
    Secondary accession number(s): D6W5D7
    , Q86W14, Q8WU92, Q96JL6, Q9H163, Q9H164, Q9H3G9, Q9NWA7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 1, 2004
    Last sequence update: March 1, 2004
    Last modified: October 1, 2014
    This is version 124 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3