Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

VIP36-like protein

Gene

LMAN2L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in the regulation of export from the endoplasmic reticulum of a subset of glycoproteins. May function as a regulator of ERGIC-53.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei93 – 931CarbohydratePROSITE-ProRule annotation
Binding sitei128 – 1281CarbohydratePROSITE-ProRule annotation
Metal bindingi159 – 1591CalciumPROSITE-ProRule annotation
Metal bindingi161 – 1611CalciumPROSITE-ProRule annotation
Metal bindingi163 – 1631CalciumPROSITE-ProRule annotation
Binding sitei188 – 1881CarbohydratePROSITE-ProRule annotation
Metal bindingi191 – 1911CalciumPROSITE-ProRule annotation

GO - Molecular functioni

  • mannose binding Source: UniProtKB
  • metal ion binding Source: UniProtKB-KW

GO - Biological processi

  • ER to Golgi vesicle-mediated transport Source: UniProtKB
  • protein folding Source: UniProtKB
  • protein transport Source: UniProtKB
Complete GO annotation...

Keywords - Ligandi

Lectin, Metal-binding

Enzyme and pathway databases

ReactomeiR-HSA-204005. COPII (Coat Protein 2) Mediated Vesicle Transport.
R-HSA-5694530. Cargo concentration in the ER.

Names & Taxonomyi

Protein namesi
Recommended name:
VIP36-like protein
Alternative name(s):
Lectin mannose-binding 2-like
Short name:
LMAN2-like protein
Gene namesi
Name:LMAN2L
Synonyms:VIPL
ORF Names:PSEC0028, UNQ368/PRO704
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:19263. LMAN2L.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini45 – 313269LumenalSequence analysisAdd
BLAST
Transmembranei314 – 33623HelicalSequence analysisAdd
BLAST
Topological domaini337 – 34812CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • endoplasmic reticulum membrane Source: UniProtKB
  • ER to Golgi transport vesicle Source: UniProtKB
  • Golgi apparatus Source: UniProtKB
  • Golgi membrane Source: UniProtKB-SubCell
  • integral component of membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi344 – 3463RKR → SSS: Loss of ER retention. 1 Publication

Organism-specific databases

PharmGKBiPA134937652.

Polymorphism and mutation databases

BioMutaiLMAN2L.
DMDMi29611906.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 4444Sequence analysisAdd
BLAST
Chaini45 – 348304VIP36-like proteinPRO_0000017668Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi181 – 1811N-linked (GlcNAc...) (high mannose)1 Publication
Disulfide bondi200 ↔ 237PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

EPDiQ9H0V9.
MaxQBiQ9H0V9.
PaxDbiQ9H0V9.
PRIDEiQ9H0V9.
TopDownProteomicsiQ9H0V9-1. [Q9H0V9-1]
Q9H0V9-2. [Q9H0V9-2]

PTM databases

iPTMnetiQ9H0V9.
PhosphoSiteiQ9H0V9.
SwissPalmiQ9H0V9.

Expressioni

Tissue specificityi

Expressed in numerous tissues. Highest expression in skeletal muscle and kidney, intermediate levels in heart, liver and placenta, low levels in brain, thymus, spleen, small intestine and lung.1 Publication

Gene expression databases

BgeeiQ9H0V9.
CleanExiHS_LMAN2L.
ExpressionAtlasiQ9H0V9. baseline and differential.
GenevisibleiQ9H0V9. HS.

Organism-specific databases

HPAiHPA026600.

Interactioni

Protein-protein interaction databases

BioGridi123525. 35 interactions.
IntActiQ9H0V9. 3 interactions.
MINTiMINT-5003536.
STRINGi9606.ENSP00000366280.

Structurei

3D structure databases

ProteinModelPortaliQ9H0V9.
SMRiQ9H0V9. Positions 49-277.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini49 – 274226L-type lectin-likePROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni161 – 1633Carbohydrate bindingPROSITE-ProRule annotation
Regioni258 – 2603Carbohydrate bindingPROSITE-ProRule annotation

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi344 – 3463Endoplasmic reticulum retention signal

Sequence similaritiesi

Contains 1 L-type lectin-like domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3839. Eukaryota.
ENOG410YH8V. LUCA.
GeneTreeiENSGT00530000062977.
HOGENOMiHOG000164540.
HOVERGENiHBG052334.
InParanoidiQ9H0V9.
KOiK10083.
OMAiGQGPQQV.
PhylomeDBiQ9H0V9.
TreeFamiTF313311.

Family and domain databases

Gene3Di2.60.120.200. 1 hit.
InterProiIPR013320. ConA-like_dom.
IPR005052. Lectin_leg.
[Graphical view]
PfamiPF03388. Lectin_leg-like. 1 hit.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 1 hit.
PROSITEiPS51328. L_LECTIN_LIKE. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H0V9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAATLGPLGS WQQWRRCLSA RDGSRMLLLL LLLGSGQGPQ QVGAGQTFEY
60 70 80 90 100
LKREHSLSKP YQGVGTGSSS LWNLMGNAMV MTQYIRLTPD MQSKQGALWN
110 120 130 140 150
RVPCFLRDWE LQVHFKIHGQ GKKNLHGDGL AIWYTKDRMQ PGPVFGNMDK
160 170 180 190 200
FVGLGVFVDT YPNEEKQQER VFPYISAMVN NGSLSYDHER DGRPTELGGC
210 220 230 240 250
TAIVRNLHYD TFLVIRYVKR HLTIMMDIDG KHEWRDCIEV PGVRLPRGYY
260 270 280 290 300
FGTSSITGDL SDNHDVISLK LFELTVERTP EEEKLHRDVF LPSVDNMKLP
310 320 330 340
EMTAPLPPLS GLALFLIVFF SLVFSVFAIV IGIILYNKWQ EQSRKRFY
Length:348
Mass (Da):39,711
Last modified:March 1, 2001 - v1
Checksum:iF79382E20AE67751
GO
Isoform 2 (identifier: Q9H0V9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     169-169: E → EAQKRRYSPGVQ

Show »
Length:359
Mass (Da):40,982
Checksum:iAD6D7005E85787B1
GO
Isoform 3 (identifier: Q9H0V9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MAATLGPLGSWQQWRRCLSARDGSRMLLLLLLLGS → MDKERRICMGMAWQSGTQRIGCSQAQKRRYSPGVQ
     36-169: Missing.

Note: No experimental confirmation available.
Show »
Length:214
Mass (Da):24,712
Checksum:iCBAA3745F78E3D39
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti4 – 41T → A in BAC11559 (PubMed:16303743).Curated
Sequence conflicti69 – 691S → P in BAD96548 (Ref. 5) Curated
Sequence conflicti288 – 2881D → G in BAC11559 (PubMed:16303743).Curated
Sequence conflicti345 – 3451K → R in BAD96548 (Ref. 5) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3535MAATL…LLLGS → MDKERRICMGMAWQSGTQRI GCSQAQKRRYSPGVQ in isoform 3. 1 PublicationVSP_054439Add
BLAST
Alternative sequencei36 – 169134Missing in isoform 3. 1 PublicationVSP_054440Add
BLAST
Alternative sequencei169 – 1691E → EAQKRRYSPGVQ in isoform 2. 1 PublicationVSP_017940

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ549957 mRNA. Translation: CAD71268.1.
AL136617 mRNA. Translation: CAB66552.1.
AY358929 mRNA. Translation: AAQ89288.1.
AK299740 mRNA. Translation: BAG61635.1.
AK222828 mRNA. Translation: BAD96548.1.
AK075347 mRNA. Translation: BAC11559.1.
BX648002 mRNA. Translation: CAH56196.1.
AC068539 Genomic DNA. Translation: AAX93211.1.
CH471207 Genomic DNA. Translation: EAW71341.1.
CH471207 Genomic DNA. Translation: EAW71343.1.
BC000347 mRNA. Translation: AAH00347.2.
BC005822 mRNA. Translation: AAH05822.2.
BC005862 mRNA. Translation: AAH05862.2.
BC067265 mRNA. Translation: AAH67265.1.
CCDSiCCDS2023.1. [Q9H0V9-1]
CCDS46365.1. [Q9H0V9-2]
RefSeqiNP_001135764.1. NM_001142292.1. [Q9H0V9-2]
NP_110432.1. NM_030805.3. [Q9H0V9-1]
UniGeneiHs.655743.

Genome annotation databases

EnsembliENST00000264963; ENSP00000264963; ENSG00000114988. [Q9H0V9-1]
ENST00000377079; ENSP00000366280; ENSG00000114988. [Q9H0V9-2]
GeneIDi81562.
KEGGihsa:81562.
UCSCiuc002swu.4. human. [Q9H0V9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ549957 mRNA. Translation: CAD71268.1.
AL136617 mRNA. Translation: CAB66552.1.
AY358929 mRNA. Translation: AAQ89288.1.
AK299740 mRNA. Translation: BAG61635.1.
AK222828 mRNA. Translation: BAD96548.1.
AK075347 mRNA. Translation: BAC11559.1.
BX648002 mRNA. Translation: CAH56196.1.
AC068539 Genomic DNA. Translation: AAX93211.1.
CH471207 Genomic DNA. Translation: EAW71341.1.
CH471207 Genomic DNA. Translation: EAW71343.1.
BC000347 mRNA. Translation: AAH00347.2.
BC005822 mRNA. Translation: AAH05822.2.
BC005862 mRNA. Translation: AAH05862.2.
BC067265 mRNA. Translation: AAH67265.1.
CCDSiCCDS2023.1. [Q9H0V9-1]
CCDS46365.1. [Q9H0V9-2]
RefSeqiNP_001135764.1. NM_001142292.1. [Q9H0V9-2]
NP_110432.1. NM_030805.3. [Q9H0V9-1]
UniGeneiHs.655743.

3D structure databases

ProteinModelPortaliQ9H0V9.
SMRiQ9H0V9. Positions 49-277.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123525. 35 interactions.
IntActiQ9H0V9. 3 interactions.
MINTiMINT-5003536.
STRINGi9606.ENSP00000366280.

PTM databases

iPTMnetiQ9H0V9.
PhosphoSiteiQ9H0V9.
SwissPalmiQ9H0V9.

Polymorphism and mutation databases

BioMutaiLMAN2L.
DMDMi29611906.

Proteomic databases

EPDiQ9H0V9.
MaxQBiQ9H0V9.
PaxDbiQ9H0V9.
PRIDEiQ9H0V9.
TopDownProteomicsiQ9H0V9-1. [Q9H0V9-1]
Q9H0V9-2. [Q9H0V9-2]

Protocols and materials databases

DNASUi81562.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000264963; ENSP00000264963; ENSG00000114988. [Q9H0V9-1]
ENST00000377079; ENSP00000366280; ENSG00000114988. [Q9H0V9-2]
GeneIDi81562.
KEGGihsa:81562.
UCSCiuc002swu.4. human. [Q9H0V9-1]

Organism-specific databases

CTDi81562.
GeneCardsiLMAN2L.
HGNCiHGNC:19263. LMAN2L.
HPAiHPA026600.
MIMi609552. gene.
neXtProtiNX_Q9H0V9.
PharmGKBiPA134937652.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3839. Eukaryota.
ENOG410YH8V. LUCA.
GeneTreeiENSGT00530000062977.
HOGENOMiHOG000164540.
HOVERGENiHBG052334.
InParanoidiQ9H0V9.
KOiK10083.
OMAiGQGPQQV.
PhylomeDBiQ9H0V9.
TreeFamiTF313311.

Enzyme and pathway databases

ReactomeiR-HSA-204005. COPII (Coat Protein 2) Mediated Vesicle Transport.
R-HSA-5694530. Cargo concentration in the ER.

Miscellaneous databases

ChiTaRSiLMAN2L. human.
GeneWikiiLMAN2L.
GenomeRNAii81562.
PROiQ9H0V9.
SOURCEiSearch...

Gene expression databases

BgeeiQ9H0V9.
CleanExiHS_LMAN2L.
ExpressionAtlasiQ9H0V9. baseline and differential.
GenevisibleiQ9H0V9. HS.

Family and domain databases

Gene3Di2.60.120.200. 1 hit.
InterProiIPR013320. ConA-like_dom.
IPR005052. Lectin_leg.
[Graphical view]
PfamiPF03388. Lectin_leg-like. 1 hit.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 1 hit.
PROSITEiPS51328. L_LECTIN_LIKE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Profile-based data base scanning for animal L-type lectins and characterization of VIPL, a novel VIP36-like endoplasmic reticulum protein."
    Nufer O., Mitrovic S., Hauri H.-P.
    J. Biol. Chem. 278:15886-15896(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION, STRUCTURE OF CARBOHYDRATES, SUBCELLULAR LOCATION, MUTAGENESIS OF 344-ARG--ARG-346.
    Tissue: Liver.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain.
  5. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Liver.
  6. "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries."
    Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.
    , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.
    DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Teratocarcinoma.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  8. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Muscle and Uterus.
  11. "VIPL, a VIP36-like membrane protein with a putative function in the export of glycoproteins from the endoplasmic reticulum."
    Neve E.P.A., Svensson K., Fuxe J., Pettersson R.F.
    Exp. Cell Res. 288:70-83(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION, FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION.
  12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiLMA2L_HUMAN
AccessioniPrimary (citable) accession number: Q9H0V9
Secondary accession number(s): B4DSH3
, D3DXH6, Q53GV3, Q53S67, Q63HN6, Q8NBQ6, Q9BQ14
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 4, 2003
Last sequence update: March 1, 2001
Last modified: June 8, 2016
This is version 146 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.