Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9H0R8 (GBRL1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 119. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Gamma-aminobutyric acid receptor-associated protein-like 1
Alternative name(s):
Early estrogen-regulated protein
GABA(A) receptor-associated protein-like 1
Glandular epithelial cell protein 1
Short name=GEC-1
Gene names
Name:GABARAPL1
Synonyms:GEC1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length117 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. Ref.10 Ref.12

Subunit structure

Interacts with GABRG2 and beta-tubulin By similarity. Interacts with ATG13, OPRK1, RB1CC1 and ULK1. Interacts with TP53INP1 and TP53INP2. Directly interacts with SQSTM1. Interacts with ATG3, ATG7 and MAP15. Interacts with TECPR2. Ref.10 Ref.11 Ref.13 Ref.15 Ref.16 Ref.17

Subcellular location

Cytoplasmcytoskeleton. Cytoplasmic vesicle membrane; Lipid-anchor. Endoplasmic reticulum By similarity. Golgi apparatus By similarity. Cytoplasmic vesicleautophagosome Ref.11 Ref.12 Ref.19.

Tissue specificity

Ubiquitous. Expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta and skeletal muscle. Expressed at very low levels in thymus and small intestine. In the brain, expression is particularly intense in motoneurons in the embryo and in neurons involved in somatomotor and neuroendocrine functions in the adult, particularly in the substantia nigra pars compacta. Ref.1 Ref.2 Ref.19

Post-translational modification

The precursor molecule is cleaved by ATG4B to form the cytosolic form, GABARAPL1-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, GABARAPL1-II By similarity. ATG4B also mediates the delipidation required for GABARAPL1 recycling when autophagosomes fuse with lysosomes (Ref.12). Ref.12

The Legionella effector RavZ is a deconjugating enzyme that produces an ATG8 product that would be resistant to reconjugation by the host machinery due to the cleavage of the reactive C-terminal glycine.

Sequence similarities

Belongs to the ATG8 family.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9H0R8-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9H0R8-2)

The sequence of this isoform differs from the canonical sequence as follows:
     97-117: DNHEEDYFLYVAYSDESVYGK → VMVLVAQYWMPSSAVWHPLALVLDALITHLRSGAEGVIYPDPLTYGSVRL

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 116116Gamma-aminobutyric acid receptor-associated protein-like 1
PRO_0000212369
Propeptide1171Removed in mature form
PRO_0000420208

Regions

Region1 – 2222Interaction with beta-tubulin By similarity
Region36 – 6833Interaction with GABRG2 By similarity

Sites

Site115 – 1162Cleavage; by RavZ
Site116 – 1172Cleavage; by ATG4B

Amino acid modifications

Lipidation1161Phosphatidylethanolamine amidated glycine Probable

Natural variations

Alternative sequence97 – 11721DNHEE…SVYGK → VMVLVAQYWMPSSAVWHPLA LVLDALITHLRSGAEGVIYP DPLTYGSVRL in isoform 2.
VSP_044422

Experimental info

Mutagenesis1161G → A: No processing of precursor. Ref.12

Secondary structure

................. 117
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 1, 2001. Version 1.
Checksum: 7F56E345255F564B

FASTA11714,044
        10         20         30         40         50         60 
MKFQYKEDHP FEYRKKEGEK IRKKYPDRVP VIVEKAPKAR VPDLDKRKYL VPSDLTVGQF 

        70         80         90        100        110 
YFLIRKRIHL RPEDALFFFV NNTIPPTSAT MGQLYEDNHE EDYFLYVAYS DESVYGK 

« Hide

Isoform 2 [UniParc].

Checksum: FC0CDEB0EF8F4529
Show »

FASTA14617,008

References

« Hide 'large scale' references
[1]"A novel early estrogen-regulated gene gec1 encodes a protein related to GABARAP."
Vernier-Magnin S., Muller S., Sallot M., Radom J., Musard J.-F., Adami P., Dulieu P., Remy-Martin J.-P., Jouvenot M., Fraichard A.
Biochem. Biophys. Res. Commun. 284:118-125(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
Tissue: Placenta.
[2]"Cloning, expression patterns, and chromosome localization of three human and two mouse homologues of GABA(A) receptor-associated protein."
Xin Y., Yu L., Chen Z., Zheng L., Fu Q., Jiang J., Zhang P., Gong R., Zhao S.
Genomics 74:408-413(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
[3]"Alternative splicing pattern analysis of human Atg8 family proteins."
Liu C., Yu L.
Submitted (SEP-2011) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
[4]"Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs."
Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. expand/collapse author list , Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.
Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[5]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Thymus.
[6]"Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[7]"The finished DNA sequence of human chromosome 12."
Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. expand/collapse author list , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[9]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain and Colon.
[10]"GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor."
Chen C., Li J.-G., Chen Y., Huang P., Wang Y., Liu-Chen L.-Y.
J. Biol. Chem. 281:7983-7993(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH OPRK1.
[11]"p62/SQSTM1 binds directly to Atg8/LC3 to facilitate degradation of ubiquitinated protein aggregates by autophagy."
Pankiv S., Clausen T.H., Lamark T., Brech A., Bruun J.A., Outzen H., Overvatn A., Bjorkoy G., Johansen T.
J. Biol. Chem. 282:24131-24145(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH SQSTM1, SUBCELLULAR LOCATION.
[12]"GABARAPL1 (GEC1) associates with autophagic vesicles."
Chakrama F.Z., Seguin-Py S., Le Grand J.N., Fraichard A., Delage-Mourroux R., Despouy G., Perez V., Jouvenot M., Boyer-Guittaut M.
Autophagy 6:495-505(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBCELLULAR LOCATION, PROTEOLYTIC CLEAVAGE, LIPIDATION AT GLY-116, MUTAGENESIS OF GLY-116.
[13]"Network organization of the human autophagy system."
Behrends C., Sowa M.E., Gygi S.P., Harper J.W.
Nature 466:68-76(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH TECPR2.
[14]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[15]"MAPK15/ERK8 stimulates autophagy by interacting with LC3 and GABARAP proteins."
Colecchia D., Strambi A., Sanzone S., Iavarone C., Rossi M., Dall'Armi C., Piccioni F., Verrotti di Pianella A., Chiariello M.
Autophagy 8:1724-1740(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH MAPK15.
[16]"ATG8 family proteins act as scaffolds for assembly of the ULK complex: sequence requirements for LC3-interacting region (LIR) motifs."
Alemu E.A., Lamark T., Torgersen K.M., Birgisdottir A.B., Larsen K.B., Jain A., Olsvik H., Overvatn A., Kirkin V., Johansen T.
J. Biol. Chem. 287:39275-39290(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH ATG13; RB1CC1 AND ULK1.
[17]"DOR/Tp53inp2 and Tp53inp1 constitute a metazoan gene family encoding dual regulators of autophagy and transcription."
Sancho A., Duran J., Garcia-Espana A., Mauvezin C., Alemu E.A., Lamark T., Macias M.J., Desalle R., Royo M., Sala D., Chicote J.U., Palacin M., Johansen T., Zorzano A.
PLoS ONE 7:E34034-E34034(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH TP53INP1 AND TP53INP2.
[18]"The Legionella effector RavZ inhibits host autophagy through irreversible Atg8 deconjugation."
Choy A., Dancourt J., Mugo B., O'Connor T.J., Isberg R.R., Melia T.J., Roy C.R.
Science 338:1072-1076(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: DECONJUGATION BY LEGIONELLA RAVZ.
[19]"Specific distribution of the autophagic protein GABARAPL1/GEC1 in the developing and adult mouse brain and identification of neuronal populations expressing GABARAPL1/GEC1."
Le Grand J.N., Bon K., Fraichard A., Zhang J., Jouvenot M., Risold P.Y., Boyer-Guittaut M., Delage-Mourroux R.
PLoS ONE 8:E63133-E63133(2013) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
[20]"Crystal structure of human gamma-aminobutyric acid receptor-associated protein-like 1 (GABARAP1)."
Structural genomics consortium (SGC)
Submitted (SEP-2007) to the PDB data bank
Cited for: X-RAY CRYSTALLOGRAPHY (1.65 ANGSTROMS) OF 3-111.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF287012 mRNA. Translation: AAK55962.1.
AF087847 mRNA. Translation: AAK20399.1.
JN663881 mRNA. Translation: AEZ06294.1.
AL136676 mRNA. Translation: CAB66611.1.
AK303581 mRNA. Translation: BAG64599.1.
CR533480 mRNA. Translation: CAG38511.1.
AC115676 Genomic DNA. No translation available.
CH471094 Genomic DNA. Translation: EAW96164.1.
BC009309 mRNA. Translation: AAH09309.1.
BC028315 mRNA. Translation: AAH28315.1.
CCDSCCDS8620.1. [Q9H0R8-1]
RefSeqNP_113600.1. NM_031412.2. [Q9H0R8-1]
XP_005253401.1. XM_005253344.2. [Q9H0R8-2]
UniGeneHs.524250.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2L8JNMR-A2-115[»]
2R2QX-ray1.65A/B3-111[»]
ProteinModelPortalQ9H0R8.
SMRQ9H0R8. Positions 3-111.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid117223. 59 interactions.
IntActQ9H0R8. 500 interactions.
MINTMINT-1456875.

PTM databases

PhosphoSiteQ9H0R8.

Polymorphism databases

DMDM44887973.

Proteomic databases

MaxQBQ9H0R8.
PaxDbQ9H0R8.
PRIDEQ9H0R8.

Protocols and materials databases

DNASU23710.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000266458; ENSP00000266458; ENSG00000139112. [Q9H0R8-1]
ENST00000421801; ENSP00000411256; ENSG00000139112. [Q9H0R8-2]
ENST00000543602; ENSP00000445857; ENSG00000139112. [Q9H0R8-2]
ENST00000545887; ENSP00000444186; ENSG00000139112. [Q9H0R8-1]
GeneID23710.
KEGGhsa:23710.
UCSCuc001qxs.3. human. [Q9H0R8-1]
uc010shb.1. human. [Q9H0R8-2]

Organism-specific databases

CTD23710.
GeneCardsGC12P010365.
H-InvDBHIX0036758.
HGNCHGNC:4068. GABARAPL1.
HPAHPA051386.
MIM607420. gene.
neXtProtNX_Q9H0R8.
PharmGKBPA28481.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG281408.
HOGENOMHOG000232034.
HOVERGENHBG051706.
InParanoidQ9H0R8.
KOK08341.
OMASRIREKH.
PhylomeDBQ9H0R8.
TreeFamTF314556.

Gene expression databases

ArrayExpressQ9H0R8.
BgeeQ9H0R8.
CleanExHS_GABARAPL1.
GenevestigatorQ9H0R8.

Family and domain databases

InterProIPR004241. Atg8_like.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PANTHERPTHR10969. PTHR10969. 1 hit.
PfamPF02991. Atg8. 1 hit.
[Graphical view]
SUPFAMSSF54236. SSF54236. 1 hit.
ProtoNetSearch...

Other

ChiTaRSGABARAPL1. human.
EvolutionaryTraceQ9H0R8.
GenomeRNAi23710.
NextBio35476887.
PMAP-CutDBQ9H0R8.
PROQ9H0R8.
SOURCESearch...

Entry information

Entry nameGBRL1_HUMAN
AccessionPrimary (citable) accession number: Q9H0R8
Secondary accession number(s): B4E0Y7, Q6FIE6
Entry history
Integrated into UniProtKB/Swiss-Prot: March 1, 2004
Last sequence update: March 1, 2001
Last modified: July 9, 2014
This is version 119 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM