Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Gamma-aminobutyric acid receptor-associated protein-like 1

Gene

GABARAPL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.2 Publications

GO - Molecular functioni

  • beta-tubulin binding Source: UniProtKB
  • GABA receptor binding Source: UniProtKB
  • Tat protein binding Source: UniProtKB
  • ubiquitin protein ligase binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Autophagy

Enzyme and pathway databases

BioCyciZFISH:ENSG00000139112-MONOMER.
ReactomeiR-HSA-1632852. Macroautophagy.
SIGNORiQ9H0R8.

Names & Taxonomyi

Protein namesi
Recommended name:
Gamma-aminobutyric acid receptor-associated protein-like 1
Alternative name(s):
Early estrogen-regulated protein
GABA(A) receptor-associated protein-like 1
Glandular epithelial cell protein 1
Short name:
GEC-1
Gene namesi
Name:GABARAPL1
Synonyms:GEC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:4068. GABARAPL1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Endoplasmic reticulum, Golgi apparatus, Membrane, Microtubule

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi116G → A: No processing of precursor. 1 Publication1

Organism-specific databases

DisGeNETi23710.
OpenTargetsiENSG00000139112.
PharmGKBiPA28481.

Polymorphism and mutation databases

BioMutaiGABARAPL1.
DMDMi44887973.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002123691 – 116Gamma-aminobutyric acid receptor-associated protein-like 1Add BLAST116
PropeptideiPRO_0000420208117Removed in mature form1

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi116Phosphatidylethanolamine amidated glycine1 Publication1

Post-translational modificationi

The precursor molecule is cleaved by ATG4B to form the cytosolic form, GABARAPL1-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, GABARAPL1-II (By similarity). ATG4B also mediates the delipidation required for GABARAPL1 recycling when autophagosomes fuse with lysosomes (PubMed:20404487).By similarity1 Publication
The Legionella effector RavZ is a deconjugating enzyme that produces an ATG8 product that would be resistant to reconjugation by the host machinery due to the cleavage of the reactive C-terminal glycine.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei115 – 116Cleavage; by RavZ2
Sitei116 – 117Cleavage; by ATG4B2

Keywords - PTMi

Lipoprotein

Proteomic databases

EPDiQ9H0R8.
MaxQBiQ9H0R8.
PaxDbiQ9H0R8.
PeptideAtlasiQ9H0R8.
PRIDEiQ9H0R8.

PTM databases

iPTMnetiQ9H0R8.
PhosphoSitePlusiQ9H0R8.

Miscellaneous databases

PMAP-CutDBQ9H0R8.

Expressioni

Tissue specificityi

Ubiquitous. Expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta and skeletal muscle. Expressed at very low levels in thymus and small intestine. In the brain, expression is particularly intense in motoneurons in the embryo and in neurons involved in somatomotor and neuroendocrine functions in the adult, particularly in the substantia nigra pars compacta.3 Publications

Gene expression databases

BgeeiENSG00000139112.
CleanExiHS_GABARAPL1.
ExpressionAtlasiQ9H0R8. baseline and differential.
GenevisibleiQ9H0R8. HS.

Organism-specific databases

HPAiHPA051386.

Interactioni

Subunit structurei

Interacts with GABRG2 and beta-tubulin (By similarity). Interacts with ATG13, OPRK1, RB1CC1 and ULK1. Interacts with TP53INP1 and TP53INP2. Directly interacts with SQSTM1. Interacts with ATG3, ATG7 and MAP15. Interacts with TECPR2. Interacts with TBC1D5 (PubMed:22354992). Interacts with TRIM5 (PubMed:25127057). Interacts with MEFV and TRIM21 (PubMed:26347139).By similarity9 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
AHNAK2Q8IVF2-23EBI-746969,EBI-10217765
ATG13O751432EBI-746969,EBI-2798775
ATG2AQ2TAZ03EBI-746969,EBI-2514077
ATG3Q9NT623EBI-746969,EBI-988094
ATG4AQ8WYN05EBI-746969,EBI-3044060
ATG4BQ9Y4P19EBI-746969,EBI-712014
ATG7O953526EBI-746969,EBI-987834
Bnip3lQ9Z2F74EBI-746969,EBI-1774669From a different organism.
CALCOCO2Q131376EBI-746969,EBI-739580
CLINT1Q146772EBI-746969,EBI-1171113
DYX1C1Q8WXU22EBI-746969,EBI-2946907
FAM134CQ86VR25EBI-746969,EBI-10192441
FNIP1Q8TF402EBI-746969,EBI-2946919
FYCO1Q9BQS82EBI-746969,EBI-2869338
GBASO753236EBI-746969,EBI-307133
HADHAP409394EBI-746969,EBI-356720
HADHBP550844EBI-746969,EBI-356635
IPO5O004104EBI-746969,EBI-356424
KBTBD6Q86V974EBI-746969,EBI-2514778
KBTBD7Q8WVZ96EBI-746969,EBI-473695
KRTAP10-7P604093EBI-746969,EBI-10172290
KRTAP10-9P604113EBI-746969,EBI-10172052
KXD1Q9BQD33EBI-746969,EBI-739657
NBR1Q145964EBI-746969,EBI-742698
NCOA7Q8NI082EBI-746969,EBI-80799
NEDD4P469346EBI-746969,EBI-726944
NEK9Q8TD196EBI-746969,EBI-1044009
NSMAFQ926366EBI-746969,EBI-2947053
OPRK1P411455EBI-746969,EBI-925028
PRKAR1AP106442EBI-746969,EBI-476431
RABGAP1Q9Y3P92EBI-746969,EBI-1057545
RASSF5Q8WWW02EBI-746969,EBI-367390
RCN2Q142573EBI-746969,EBI-356710
SAFB2Q141512EBI-746969,EBI-352869
SCYL3Q8IZE33EBI-746969,EBI-1380680
SQSTM1Q1350112EBI-746969,EBI-307104
STBD1O952107EBI-746969,EBI-2947137
STK3Q131882EBI-746969,EBI-992580
STK4Q130432EBI-746969,EBI-367376
TBC1D15Q8TC072EBI-746969,EBI-1048247
TBC1D2BQ9UPU75EBI-746969,EBI-2947180
TBC1D5B9A6K13EBI-746969,EBI-10217641
TECPR2O150402EBI-746969,EBI-2946991
TNIP1Q150255EBI-746969,EBI-357849
UBA5Q9GZZ92EBI-746969,EBI-747805
ULK1O753852EBI-746969,EBI-908831
WDFY3Q8IZQ13EBI-746969,EBI-1569256

GO - Molecular functioni

  • beta-tubulin binding Source: UniProtKB
  • GABA receptor binding Source: UniProtKB
  • Tat protein binding Source: UniProtKB
  • ubiquitin protein ligase binding Source: UniProtKB

Protein-protein interaction databases

BioGridi117223. 76 interactors.
DIPiDIP-35597N.
IntActiQ9H0R8. 525 interactors.
MINTiMINT-1456875.
STRINGi9606.ENSP00000266458.

Structurei

Secondary structure

1117
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi4 – 8Combined sources5
Helixi11 – 24Combined sources14
Beta strandi28 – 35Combined sources8
Beta strandi48 – 52Combined sources5
Helixi57 – 67Combined sources11
Beta strandi77 – 80Combined sources4
Helixi91 – 98Combined sources8
Beta strandi105 – 110Combined sources6

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2L8JNMR-A2-115[»]
2R2QX-ray1.65A/B3-111[»]
5DPTX-ray2.90A/B2-117[»]
ProteinModelPortaliQ9H0R8.
SMRiQ9H0R8.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9H0R8.

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 22Interaction with beta-tubulinBy similarityAdd BLAST22
Regioni36 – 68Interaction with GABRG2By similarityAdd BLAST33

Sequence similaritiesi

Belongs to the ATG8 family.Curated

Phylogenomic databases

eggNOGiKOG1654. Eukaryota.
ENOG4111JAT. LUCA.
GeneTreeiENSGT00390000012937.
HOGENOMiHOG000232034.
HOVERGENiHBG051706.
InParanoidiQ9H0R8.
KOiK08341.
OMAiHEMLMTT.
OrthoDBiEOG091G10QX.
PhylomeDBiQ9H0R8.
TreeFamiTF314556.

Family and domain databases

CDDicd01611. GABARAP. 1 hit.
InterProiIPR004241. Atg8-like.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PANTHERiPTHR10969. PTHR10969. 1 hit.
PfamiPF02991. Atg8. 1 hit.
[Graphical view]
SUPFAMiSSF54236. SSF54236. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H0R8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKFQYKEDHP FEYRKKEGEK IRKKYPDRVP VIVEKAPKAR VPDLDKRKYL
60 70 80 90 100
VPSDLTVGQF YFLIRKRIHL RPEDALFFFV NNTIPPTSAT MGQLYEDNHE
110
EDYFLYVAYS DESVYGK
Length:117
Mass (Da):14,044
Last modified:March 1, 2001 - v1
Checksum:i7F56E345255F564B
GO
Isoform 2 (identifier: Q9H0R8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     97-117: DNHEEDYFLYVAYSDESVYGK → VMVLVAQYWMPSSAVWHPLALVLDALITHLRSGAEGVIYPDPLTYGSVRL

Show »
Length:146
Mass (Da):17,008
Checksum:iFC0CDEB0EF8F4529
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04442297 – 117DNHEE…SVYGK → VMVLVAQYWMPSSAVWHPLA LVLDALITHLRSGAEGVIYP DPLTYGSVRL in isoform 2. 2 PublicationsAdd BLAST21

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF287012 mRNA. Translation: AAK55962.1.
AF087847 mRNA. Translation: AAK20399.1.
JN663881 mRNA. Translation: AEZ06294.1.
AL136676 mRNA. Translation: CAB66611.1.
AK303581 mRNA. Translation: BAG64599.1.
CR533480 mRNA. Translation: CAG38511.1.
AC115676 Genomic DNA. No translation available.
CH471094 Genomic DNA. Translation: EAW96164.1.
BC009309 mRNA. Translation: AAH09309.1.
BC028315 mRNA. Translation: AAH28315.1.
CCDSiCCDS8620.1. [Q9H0R8-1]
RefSeqiNP_113600.1. NM_031412.2. [Q9H0R8-1]
XP_005253401.1. XM_005253344.4. [Q9H0R8-2]
UniGeneiHs.524250.

Genome annotation databases

EnsembliENST00000266458; ENSP00000266458; ENSG00000139112. [Q9H0R8-1]
ENST00000421801; ENSP00000411256; ENSG00000139112. [Q9H0R8-2]
ENST00000543602; ENSP00000445857; ENSG00000139112. [Q9H0R8-2]
ENST00000545887; ENSP00000444186; ENSG00000139112. [Q9H0R8-1]
GeneIDi23710.
KEGGihsa:23710.
UCSCiuc001qxs.4. human. [Q9H0R8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF287012 mRNA. Translation: AAK55962.1.
AF087847 mRNA. Translation: AAK20399.1.
JN663881 mRNA. Translation: AEZ06294.1.
AL136676 mRNA. Translation: CAB66611.1.
AK303581 mRNA. Translation: BAG64599.1.
CR533480 mRNA. Translation: CAG38511.1.
AC115676 Genomic DNA. No translation available.
CH471094 Genomic DNA. Translation: EAW96164.1.
BC009309 mRNA. Translation: AAH09309.1.
BC028315 mRNA. Translation: AAH28315.1.
CCDSiCCDS8620.1. [Q9H0R8-1]
RefSeqiNP_113600.1. NM_031412.2. [Q9H0R8-1]
XP_005253401.1. XM_005253344.4. [Q9H0R8-2]
UniGeneiHs.524250.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2L8JNMR-A2-115[»]
2R2QX-ray1.65A/B3-111[»]
5DPTX-ray2.90A/B2-117[»]
ProteinModelPortaliQ9H0R8.
SMRiQ9H0R8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117223. 76 interactors.
DIPiDIP-35597N.
IntActiQ9H0R8. 525 interactors.
MINTiMINT-1456875.
STRINGi9606.ENSP00000266458.

PTM databases

iPTMnetiQ9H0R8.
PhosphoSitePlusiQ9H0R8.

Polymorphism and mutation databases

BioMutaiGABARAPL1.
DMDMi44887973.

Proteomic databases

EPDiQ9H0R8.
MaxQBiQ9H0R8.
PaxDbiQ9H0R8.
PeptideAtlasiQ9H0R8.
PRIDEiQ9H0R8.

Protocols and materials databases

DNASUi23710.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000266458; ENSP00000266458; ENSG00000139112. [Q9H0R8-1]
ENST00000421801; ENSP00000411256; ENSG00000139112. [Q9H0R8-2]
ENST00000543602; ENSP00000445857; ENSG00000139112. [Q9H0R8-2]
ENST00000545887; ENSP00000444186; ENSG00000139112. [Q9H0R8-1]
GeneIDi23710.
KEGGihsa:23710.
UCSCiuc001qxs.4. human. [Q9H0R8-1]

Organism-specific databases

CTDi23710.
DisGeNETi23710.
GeneCardsiGABARAPL1.
H-InvDBHIX0036758.
HGNCiHGNC:4068. GABARAPL1.
HPAiHPA051386.
MIMi607420. gene.
neXtProtiNX_Q9H0R8.
OpenTargetsiENSG00000139112.
PharmGKBiPA28481.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1654. Eukaryota.
ENOG4111JAT. LUCA.
GeneTreeiENSGT00390000012937.
HOGENOMiHOG000232034.
HOVERGENiHBG051706.
InParanoidiQ9H0R8.
KOiK08341.
OMAiHEMLMTT.
OrthoDBiEOG091G10QX.
PhylomeDBiQ9H0R8.
TreeFamiTF314556.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000139112-MONOMER.
ReactomeiR-HSA-1632852. Macroautophagy.
SIGNORiQ9H0R8.

Miscellaneous databases

ChiTaRSiGABARAPL1. human.
EvolutionaryTraceiQ9H0R8.
GenomeRNAii23710.
PMAP-CutDBQ9H0R8.
PROiQ9H0R8.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000139112.
CleanExiHS_GABARAPL1.
ExpressionAtlasiQ9H0R8. baseline and differential.
GenevisibleiQ9H0R8. HS.

Family and domain databases

CDDicd01611. GABARAP. 1 hit.
InterProiIPR004241. Atg8-like.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PANTHERiPTHR10969. PTHR10969. 1 hit.
PfamiPF02991. Atg8. 1 hit.
[Graphical view]
SUPFAMiSSF54236. SSF54236. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiGBRL1_HUMAN
AccessioniPrimary (citable) accession number: Q9H0R8
Secondary accession number(s): B4E0Y7, Q6FIE6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 1, 2004
Last sequence update: March 1, 2001
Last modified: November 30, 2016
This is version 146 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.