Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9H0R8

- GBRL1_HUMAN

UniProt

Q9H0R8 - GBRL1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Gamma-aminobutyric acid receptor-associated protein-like 1

Gene

GABARAPL1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.2 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei115 – 1162Cleavage; by RavZ
Sitei116 – 1172Cleavage; by ATG4B

GO - Molecular functioni

  1. beta-tubulin binding Source: UniProtKB
  2. GABA receptor binding Source: UniProtKB

GO - Biological processi

  1. autophagy Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Autophagy

Names & Taxonomyi

Protein namesi
Recommended name:
Gamma-aminobutyric acid receptor-associated protein-like 1
Alternative name(s):
Early estrogen-regulated protein
GABA(A) receptor-associated protein-like 1
Glandular epithelial cell protein 1
Short name:
GEC-1
Gene namesi
Name:GABARAPL1
Synonyms:GEC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:4068. GABARAPL1.

Subcellular locationi

GO - Cellular componenti

  1. autophagic vacuole Source: MGI
  2. cell body Source: Ensembl
  3. cytoplasmic vesicle Source: UniProtKB-KW
  4. dendrite cytoplasm Source: Ensembl
  5. dendrite membrane Source: Ensembl
  6. endoplasmic reticulum Source: UniProtKB-KW
  7. Golgi apparatus Source: UniProtKB-KW
  8. intracellular Source: LIFEdb
  9. microtubule Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Endoplasmic reticulum, Golgi apparatus, Membrane, Microtubule

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi116 – 1161G → A: No processing of precursor. 1 Publication

Organism-specific databases

PharmGKBiPA28481.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 116116Gamma-aminobutyric acid receptor-associated protein-like 1PRO_0000212369Add
BLAST
Propeptidei117 – 1171Removed in mature formPRO_0000420208

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Lipidationi116 – 1161Phosphatidylethanolamine amidated glycine1 Publication

Post-translational modificationi

The precursor molecule is cleaved by ATG4B to form the cytosolic form, GABARAPL1-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, GABARAPL1-II (By similarity). ATG4B also mediates the delipidation required for GABARAPL1 recycling when autophagosomes fuse with lysosomes (PubMed:20404487).By similarity1 Publication
The Legionella effector RavZ is a deconjugating enzyme that produces an ATG8 product that would be resistant to reconjugation by the host machinery due to the cleavage of the reactive C-terminal glycine.1 Publication

Keywords - PTMi

Lipoprotein

Proteomic databases

MaxQBiQ9H0R8.
PaxDbiQ9H0R8.
PRIDEiQ9H0R8.

PTM databases

PhosphoSiteiQ9H0R8.

Miscellaneous databases

PMAP-CutDBQ9H0R8.

Expressioni

Tissue specificityi

Ubiquitous. Expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta and skeletal muscle. Expressed at very low levels in thymus and small intestine. In the brain, expression is particularly intense in motoneurons in the embryo and in neurons involved in somatomotor and neuroendocrine functions in the adult, particularly in the substantia nigra pars compacta.3 Publications

Gene expression databases

BgeeiQ9H0R8.
CleanExiHS_GABARAPL1.
ExpressionAtlasiQ9H0R8. baseline and differential.
GenevestigatoriQ9H0R8.

Organism-specific databases

HPAiHPA051386.

Interactioni

Subunit structurei

Interacts with GABRG2 and beta-tubulin (By similarity). Interacts with ATG13, OPRK1, RB1CC1 and ULK1. Interacts with TP53INP1 and TP53INP2. Directly interacts with SQSTM1. Interacts with ATG3, ATG7 and MAP15. Interacts with TECPR2.By similarity6 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ATG13O751432EBI-746969,EBI-2798775
ATG2AQ2TAZ03EBI-746969,EBI-2514077
ATG3Q9NT623EBI-746969,EBI-988094
ATG4BQ9Y4P17EBI-746969,EBI-712014
ATG7O953526EBI-746969,EBI-987834
Bnip3lQ9Z2F74EBI-3464833,EBI-1774669From a different organism.
CLINT1Q146772EBI-746969,EBI-1171113
DYX1C1Q8WXU22EBI-746969,EBI-2946907
FNIP1Q8TF402EBI-746969,EBI-2946919
FYCO1Q9BQS82EBI-746969,EBI-2869338
GBASO753236EBI-746969,EBI-307133
HADHAP409394EBI-746969,EBI-356720
HADHBP550844EBI-746969,EBI-356635
IPO5O004104EBI-746969,EBI-356424
KBTBD6Q86V974EBI-746969,EBI-2514778
KBTBD7Q8WVZ93EBI-746969,EBI-473695
NBR1Q145964EBI-746969,EBI-742698
NCOA7Q8NI082EBI-746969,EBI-80799
NEDD4P469346EBI-746969,EBI-726944
NEK9Q8TD196EBI-746969,EBI-1044009
NSMAFQ926366EBI-746969,EBI-2947053
OPRK1P411455EBI-3464833,EBI-925028
PRKAR1AP106442EBI-746969,EBI-476431
RABGAP1Q9Y3P92EBI-746969,EBI-1057545
RASSF5Q8WWW02EBI-746969,EBI-367390
SAFB2Q141512EBI-746969,EBI-352869
SQSTM1Q135017EBI-746969,EBI-307104
STBD1O952107EBI-746969,EBI-2947137
STK3Q131882EBI-746969,EBI-992580
STK4Q130432EBI-746969,EBI-367376
TBC1D15Q8TC072EBI-746969,EBI-1048247
TBC1D2BQ9UPU75EBI-746969,EBI-2947180
TECPR2O150402EBI-746969,EBI-2946991
UBA5Q9GZZ92EBI-746969,EBI-747805
ULK1O753852EBI-746969,EBI-908831

Protein-protein interaction databases

BioGridi117223. 59 interactions.
IntActiQ9H0R8. 500 interactions.
MINTiMINT-1456875.

Structurei

Secondary structure

1
117
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi4 – 85Combined sources
Helixi11 – 2414Combined sources
Beta strandi28 – 358Combined sources
Beta strandi48 – 525Combined sources
Helixi57 – 6711Combined sources
Beta strandi77 – 804Combined sources
Helixi91 – 988Combined sources
Beta strandi105 – 1106Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2L8JNMR-A2-115[»]
2R2QX-ray1.65A/B3-111[»]
ProteinModelPortaliQ9H0R8.
SMRiQ9H0R8. Positions 3-111.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9H0R8.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 2222Interaction with beta-tubulinBy similarityAdd
BLAST
Regioni36 – 6833Interaction with GABRG2By similarityAdd
BLAST

Sequence similaritiesi

Belongs to the ATG8 family.Curated

Phylogenomic databases

eggNOGiNOG281408.
GeneTreeiENSGT00390000012937.
HOGENOMiHOG000232034.
HOVERGENiHBG051706.
InParanoidiQ9H0R8.
KOiK08341.
OMAiSRIREKH.
PhylomeDBiQ9H0R8.
TreeFamiTF314556.

Family and domain databases

InterProiIPR004241. Atg8_like.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PANTHERiPTHR10969. PTHR10969. 1 hit.
PfamiPF02991. Atg8. 1 hit.
[Graphical view]
SUPFAMiSSF54236. SSF54236. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9H0R8-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKFQYKEDHP FEYRKKEGEK IRKKYPDRVP VIVEKAPKAR VPDLDKRKYL
60 70 80 90 100
VPSDLTVGQF YFLIRKRIHL RPEDALFFFV NNTIPPTSAT MGQLYEDNHE
110
EDYFLYVAYS DESVYGK
Length:117
Mass (Da):14,044
Last modified:March 1, 2001 - v1
Checksum:i7F56E345255F564B
GO
Isoform 2 (identifier: Q9H0R8-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     97-117: DNHEEDYFLYVAYSDESVYGK → VMVLVAQYWMPSSAVWHPLALVLDALITHLRSGAEGVIYPDPLTYGSVRL

Show »
Length:146
Mass (Da):17,008
Checksum:iFC0CDEB0EF8F4529
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei97 – 11721DNHEE…SVYGK → VMVLVAQYWMPSSAVWHPLA LVLDALITHLRSGAEGVIYP DPLTYGSVRL in isoform 2. 2 PublicationsVSP_044422Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF287012 mRNA. Translation: AAK55962.1.
AF087847 mRNA. Translation: AAK20399.1.
JN663881 mRNA. Translation: AEZ06294.1.
AL136676 mRNA. Translation: CAB66611.1.
AK303581 mRNA. Translation: BAG64599.1.
CR533480 mRNA. Translation: CAG38511.1.
AC115676 Genomic DNA. No translation available.
CH471094 Genomic DNA. Translation: EAW96164.1.
BC009309 mRNA. Translation: AAH09309.1.
BC028315 mRNA. Translation: AAH28315.1.
CCDSiCCDS8620.1. [Q9H0R8-1]
RefSeqiNP_113600.1. NM_031412.2. [Q9H0R8-1]
XP_005253401.1. XM_005253344.2. [Q9H0R8-2]
UniGeneiHs.524250.

Genome annotation databases

EnsembliENST00000266458; ENSP00000266458; ENSG00000139112. [Q9H0R8-1]
ENST00000421801; ENSP00000411256; ENSG00000139112. [Q9H0R8-2]
ENST00000543602; ENSP00000445857; ENSG00000139112. [Q9H0R8-2]
ENST00000545887; ENSP00000444186; ENSG00000139112. [Q9H0R8-1]
GeneIDi23710.
KEGGihsa:23710.
UCSCiuc001qxs.3. human. [Q9H0R8-1]
uc010shb.1. human. [Q9H0R8-2]

Polymorphism databases

DMDMi44887973.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF287012 mRNA. Translation: AAK55962.1 .
AF087847 mRNA. Translation: AAK20399.1 .
JN663881 mRNA. Translation: AEZ06294.1 .
AL136676 mRNA. Translation: CAB66611.1 .
AK303581 mRNA. Translation: BAG64599.1 .
CR533480 mRNA. Translation: CAG38511.1 .
AC115676 Genomic DNA. No translation available.
CH471094 Genomic DNA. Translation: EAW96164.1 .
BC009309 mRNA. Translation: AAH09309.1 .
BC028315 mRNA. Translation: AAH28315.1 .
CCDSi CCDS8620.1. [Q9H0R8-1 ]
RefSeqi NP_113600.1. NM_031412.2. [Q9H0R8-1 ]
XP_005253401.1. XM_005253344.2. [Q9H0R8-2 ]
UniGenei Hs.524250.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2L8J NMR - A 2-115 [» ]
2R2Q X-ray 1.65 A/B 3-111 [» ]
ProteinModelPortali Q9H0R8.
SMRi Q9H0R8. Positions 3-111.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 117223. 59 interactions.
IntActi Q9H0R8. 500 interactions.
MINTi MINT-1456875.

PTM databases

PhosphoSitei Q9H0R8.

Polymorphism databases

DMDMi 44887973.

Proteomic databases

MaxQBi Q9H0R8.
PaxDbi Q9H0R8.
PRIDEi Q9H0R8.

Protocols and materials databases

DNASUi 23710.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000266458 ; ENSP00000266458 ; ENSG00000139112 . [Q9H0R8-1 ]
ENST00000421801 ; ENSP00000411256 ; ENSG00000139112 . [Q9H0R8-2 ]
ENST00000543602 ; ENSP00000445857 ; ENSG00000139112 . [Q9H0R8-2 ]
ENST00000545887 ; ENSP00000444186 ; ENSG00000139112 . [Q9H0R8-1 ]
GeneIDi 23710.
KEGGi hsa:23710.
UCSCi uc001qxs.3. human. [Q9H0R8-1 ]
uc010shb.1. human. [Q9H0R8-2 ]

Organism-specific databases

CTDi 23710.
GeneCardsi GC12P010365.
H-InvDB HIX0036758.
HGNCi HGNC:4068. GABARAPL1.
HPAi HPA051386.
MIMi 607420. gene.
neXtProti NX_Q9H0R8.
PharmGKBi PA28481.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG281408.
GeneTreei ENSGT00390000012937.
HOGENOMi HOG000232034.
HOVERGENi HBG051706.
InParanoidi Q9H0R8.
KOi K08341.
OMAi SRIREKH.
PhylomeDBi Q9H0R8.
TreeFami TF314556.

Miscellaneous databases

ChiTaRSi GABARAPL1. human.
EvolutionaryTracei Q9H0R8.
GenomeRNAii 23710.
NextBioi 35476887.
PMAP-CutDB Q9H0R8.
PROi Q9H0R8.
SOURCEi Search...

Gene expression databases

Bgeei Q9H0R8.
CleanExi HS_GABARAPL1.
ExpressionAtlasi Q9H0R8. baseline and differential.
Genevestigatori Q9H0R8.

Family and domain databases

InterProi IPR004241. Atg8_like.
IPR029071. Ubiquitin-rel_dom.
[Graphical view ]
PANTHERi PTHR10969. PTHR10969. 1 hit.
Pfami PF02991. Atg8. 1 hit.
[Graphical view ]
SUPFAMi SSF54236. SSF54236. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Placenta.
  2. "Cloning, expression patterns, and chromosome localization of three human and two mouse homologues of GABA(A) receptor-associated protein."
    Xin Y., Yu L., Chen Z., Zheng L., Fu Q., Jiang J., Zhang P., Gong R., Zhao S.
    Genomics 74:408-413(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
  3. "Alternative splicing pattern analysis of human Atg8 family proteins."
    Liu C., Yu L.
    Submitted (SEP-2011) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Thymus.
  6. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  7. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain and Colon.
  10. "GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor."
    Chen C., Li J.-G., Chen Y., Huang P., Wang Y., Liu-Chen L.-Y.
    J. Biol. Chem. 281:7983-7993(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH OPRK1.
  11. "p62/SQSTM1 binds directly to Atg8/LC3 to facilitate degradation of ubiquitinated protein aggregates by autophagy."
    Pankiv S., Clausen T.H., Lamark T., Brech A., Bruun J.A., Outzen H., Overvatn A., Bjorkoy G., Johansen T.
    J. Biol. Chem. 282:24131-24145(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SQSTM1, SUBCELLULAR LOCATION.
  12. Cited for: FUNCTION, SUBCELLULAR LOCATION, PROTEOLYTIC CLEAVAGE, LIPIDATION AT GLY-116, MUTAGENESIS OF GLY-116.
  13. "Network organization of the human autophagy system."
    Behrends C., Sowa M.E., Gygi S.P., Harper J.W.
    Nature 466:68-76(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH TECPR2.
  14. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  15. Cited for: INTERACTION WITH MAPK15.
  16. "ATG8 family proteins act as scaffolds for assembly of the ULK complex: sequence requirements for LC3-interacting region (LIR) motifs."
    Alemu E.A., Lamark T., Torgersen K.M., Birgisdottir A.B., Larsen K.B., Jain A., Olsvik H., Overvatn A., Kirkin V., Johansen T.
    J. Biol. Chem. 287:39275-39290(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ATG13; RB1CC1 AND ULK1.
  17. "DOR/Tp53inp2 and Tp53inp1 constitute a metazoan gene family encoding dual regulators of autophagy and transcription."
    Sancho A., Duran J., Garcia-Espana A., Mauvezin C., Alemu E.A., Lamark T., Macias M.J., Desalle R., Royo M., Sala D., Chicote J.U., Palacin M., Johansen T., Zorzano A.
    PLoS ONE 7:E34034-E34034(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH TP53INP1 AND TP53INP2.
  18. "The Legionella effector RavZ inhibits host autophagy through irreversible Atg8 deconjugation."
    Choy A., Dancourt J., Mugo B., O'Connor T.J., Isberg R.R., Melia T.J., Roy C.R.
    Science 338:1072-1076(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: DECONJUGATION BY LEGIONELLA RAVZ.
  19. "Specific distribution of the autophagic protein GABARAPL1/GEC1 in the developing and adult mouse brain and identification of neuronal populations expressing GABARAPL1/GEC1."
    Le Grand J.N., Bon K., Fraichard A., Zhang J., Jouvenot M., Risold P.Y., Boyer-Guittaut M., Delage-Mourroux R.
    PLoS ONE 8:E63133-E63133(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  20. "Crystal structure of human gamma-aminobutyric acid receptor-associated protein-like 1 (GABARAP1)."
    Structural genomics consortium (SGC)
    Submitted (SEP-2007) to the PDB data bank
    Cited for: X-RAY CRYSTALLOGRAPHY (1.65 ANGSTROMS) OF 3-111.

Entry informationi

Entry nameiGBRL1_HUMAN
AccessioniPrimary (citable) accession number: Q9H0R8
Secondary accession number(s): B4E0Y7, Q6FIE6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 1, 2004
Last sequence update: March 1, 2001
Last modified: November 26, 2014
This is version 123 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3