Q9H0R8 (GBRL1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 105.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Gamma-aminobutyric acid receptor-associated protein-like 1 Alternative name(s): Early estrogen-regulated protein GABA(A) receptor-associated protein-like 1 Glandular epithelial cell protein 1 Short name=GEC-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 117 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Ref.10 Ref.12 |
| Subunit structure | Interacts with GABRG2 and beta-tubulin By similarity. Interacts with OPRK1. Interacts with TP53INP1 and TP53INP2. Directly interacts with SQSTM1. Ref.10 Ref.11 Ref.14 |
| Subcellular location | Cytoplasm › cytoskeleton. Cytoplasmic vesicle membrane; Lipid-anchor. Endoplasmic reticulum By similarity. Golgi apparatus By similarity. Cytoplasmic vesicle › autophagosome Ref.11 Ref.12. |
| Tissue specificity | Ubiquitous. Expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta and skeletal muscle. Expressed at very low levels in thymus and small intestine. Ref.1 Ref.2 |
| Post-translational modification | The precursor molecule is cleaved by APG4B/ATG4B. ATG4B also mediates the delipidation required for GABARAPL1 recycling when autophagosomes fuse with lysosomes. Ref.12 |
| Sequence similarities | Belongs to the MAP1 LC3 family. |
Ontologies
Binary interactions
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9H0R8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9H0R8-2) The sequence of this isoform differs from the canonical sequence as follows: 97-117: DNHEEDYFLYVAYSDESVYGK → VMVLVAQYWMPSSAVWHPLALVLDALITHLRSGAEGVIYPDPLTYGSVRL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 116 | 116 | Gamma-aminobutyric acid receptor-associated protein-like 1 | PRO_0000212369 | |||||||||||||||||||||
| Propeptide | 117 | 1 | Removed in mature form | PRO_0000420208 | |||||||||||||||||||||
Regions | |||||||||||||||||||||||||
| Region | 1 – 22 | 22 | Interaction with beta-tubulin By similarity | ||||||||||||||||||||||
| Region | 36 – 68 | 33 | Interaction with GABRG2 By similarity | ||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||
| Lipidation | 116 | 1 | Phosphatidylethanolamine amidated glycine Probable | ||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||
| Alternative sequence | 97 – 117 | 21 | DNHEE…SVYGK → VMVLVAQYWMPSSAVWHPLA LVLDALITHLRSGAEGVIYP DPLTYGSVRL in isoform 2. | VSP_044422 | |||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||
| Mutagenesis | 116 | 1 | G → A: No processing of precursor. Ref.12 | ||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||
| Helix | 4 – 8 | 5 | |||||||||||||||||||||||
| Helix | 11 – 24 | 14 | |||||||||||||||||||||||
| Beta strand | 28 – 35 | 8 | |||||||||||||||||||||||
| Beta strand | 48 – 52 | 5 | |||||||||||||||||||||||
| Helix | 57 – 67 | 11 | |||||||||||||||||||||||
| Beta strand | 77 – 80 | 4 | |||||||||||||||||||||||
| Helix | 91 – 98 | 8 | |||||||||||||||||||||||
| Beta strand | 105 – 110 | 6 | |||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel early estrogen-regulated gene gec1 encodes a protein related to GABARAP." Vernier-Magnin S., Muller S., Sallot M., Radom J., Musard J.-F., Adami P., Dulieu P., Remy-Martin J.-P., Jouvenot M., Fraichard A. Biochem. Biophys. Res. Commun. 284:118-125(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Placenta. |
| [2] | "Cloning, expression patterns, and chromosome localization of three human and two mouse homologues of GABA(A) receptor-associated protein." Xin Y., Yu L., Chen Z., Zheng L., Fu Q., Jiang J., Zhang P., Gong R., Zhao S. Genomics 74:408-413(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| [3] | "Alternative splicing pattern analysis of human Atg8 family proteins." Liu C., Yu L. Submitted (SEP-2011) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [4] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Thymus. |
| [6] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [7] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain and Colon. |
| [10] | "GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor." Chen C., Li J.-G., Chen Y., Huang P., Wang Y., Liu-Chen L.-Y. J. Biol. Chem. 281:7983-7993(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH OPRK1. |
| [11] | "p62/SQSTM1 binds directly to Atg8/LC3 to facilitate degradation of ubiquitinated protein aggregates by autophagy." Pankiv S., Clausen T.H., Lamark T., Brech A., Bruun J.A., Outzen H., Overvatn A., Bjorkoy G., Johansen T. J. Biol. Chem. 282:24131-24145(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SQSTM1, SUBCELLULAR LOCATION. |
| [12] | "GABARAPL1 (GEC1) associates with autophagic vesicles." Chakrama F.Z., Seguin-Py S., Le Grand J.N., Fraichard A., Delage-Mourroux R., Despouy G., Perez V., Jouvenot M., Boyer-Guittaut M. Autophagy 6:495-505(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, PROTEOLYTIC CLEAVAGE, LIPIDATION, MUTAGENESIS OF GLY-116. |
| [13] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [14] | "DOR/Tp53inp2 and Tp53inp1 constitute a metazoan gene family encoding dual regulators of autophagy and transcription." Sancho A., Duran J., Garcia-Espana A., Mauvezin C., Alemu E.A., Lamark T., Macias M.J., Desalle R., Royo M., Sala D., Chicote J.U., Palacin M., Johansen T., Zorzano A. PLoS ONE 7:E34034-E34034(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TP53INP1 AND TP53INP2. |
| [15] | "Crystal structure of human gamma-aminobutyric acid receptor-associated protein-like 1 (GABARAP1)." Structural genomics consortium (SGC) Submitted (SEP-2007) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (1.65 ANGSTROMS) OF 3-111. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF287012 mRNA. Translation: AAK55962.1. AF087847 mRNA. Translation: AAK20399.1. JN663881 mRNA. Translation: AEZ06294.1. AL136676 mRNA. Translation: CAB66611.1. AK303581 mRNA. Translation: BAG64599.1. CR533480 mRNA. Translation: CAG38511.1. AC115676 Genomic DNA. No translation available. CH471094 Genomic DNA. Translation: EAW96164.1. BC009309 mRNA. Translation: AAH09309.1. BC028315 mRNA. Translation: AAH28315.1. | ||||||||||||||||||
| IPI | IPI00027733. IPI00910716. | ||||||||||||||||||
| RefSeq | NP_113600.1. NM_031412.2. | ||||||||||||||||||
| UniGene | Hs.524250. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q9H0R8. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q9H0R8. 496 interactions. | ||||||||||||||||||
| MINT | MINT-1456875. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q9H0R8. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 44887973. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q9H0R8. | ||||||||||||||||||
| PRIDE | Q9H0R8. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 23710. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000266458; ENSP00000266458; ENSG00000139112. ENST00000421801; ENSP00000411256; ENSG00000139112. ENST00000543602; ENSP00000445857; ENSG00000139112. ENST00000545887; ENSP00000444186; ENSG00000139112. | ||||||||||||||||||
| GeneID | 23710. | ||||||||||||||||||
| KEGG | hsa:23710. | ||||||||||||||||||
| UCSC | uc001qxs.3. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 23710. | ||||||||||||||||||
| GeneCards | GC12P010365. | ||||||||||||||||||
| H-InvDB | HIX0036758. | ||||||||||||||||||
| HGNC | HGNC:4068. GABARAPL1. | ||||||||||||||||||
| HPA | HPA051386. | ||||||||||||||||||
| MIM | 607420. gene. | ||||||||||||||||||
| neXtProt | NX_Q9H0R8. | ||||||||||||||||||
| PharmGKB | PA28481. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG281408. | ||||||||||||||||||
| HOGENOM | HOG000232034. | ||||||||||||||||||
| HOVERGEN | HBG051706. | ||||||||||||||||||
| InParanoid | Q9H0R8. | ||||||||||||||||||
| KO | K08341. | ||||||||||||||||||
| OMA | MSSVYED. | ||||||||||||||||||
| OrthoDB | EOG4T4CWW. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q9H0R8. | ||||||||||||||||||
| Bgee | Q9H0R8. | ||||||||||||||||||
| CleanEx | HS_GABARAPL1. | ||||||||||||||||||
| Genevestigator | Q9H0R8. | ||||||||||||||||||
| GermOnline | ENSG00000139112. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR004241. Atg8_ubiquitin-like. [Graphical view] | ||||||||||||||||||
| PANTHER | PTHR10969. PTHR10969. 1 hit. | ||||||||||||||||||
| Pfam | PF02991. Atg8. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| ChiTaRS | GABARAPL1. human. | ||||||||||||||||||
| EvolutionaryTrace | Q9H0R8. | ||||||||||||||||||
| GenomeRNAi | 23710. | ||||||||||||||||||
| NextBio | 35476887. | ||||||||||||||||||
| PMAP-CutDB | Q9H0R8. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | GBRL1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H0R8 Secondary accession number(s): B4E0Y7, Q6FIE6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
