Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9H0R8

- GBRL1_HUMAN

UniProt

Q9H0R8 - GBRL1_HUMAN

Protein

Gamma-aminobutyric acid receptor-associated protein-like 1

Gene

GABARAPL1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
  1. Functioni

    Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.2 Publications

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei115 – 1162Cleavage; by RavZ
    Sitei116 – 1172Cleavage; by ATG4B

    GO - Molecular functioni

    1. beta-tubulin binding Source: UniProtKB
    2. GABA receptor binding Source: UniProtKB
    3. protein binding Source: UniProtKB

    GO - Biological processi

    1. autophagy Source: UniProtKB-KW

    Keywords - Biological processi

    Autophagy

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Gamma-aminobutyric acid receptor-associated protein-like 1
    Alternative name(s):
    Early estrogen-regulated protein
    GABA(A) receptor-associated protein-like 1
    Glandular epithelial cell protein 1
    Short name:
    GEC-1
    Gene namesi
    Name:GABARAPL1
    Synonyms:GEC1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:4068. GABARAPL1.

    Subcellular locationi

    GO - Cellular componenti

    1. autophagic vacuole Source: MGI
    2. cytoplasmic vesicle membrane Source: UniProtKB-SubCell
    3. endoplasmic reticulum Source: UniProtKB-SubCell
    4. Golgi apparatus Source: UniProtKB-SubCell
    5. intracellular Source: LIFEdb
    6. microtubule Source: UniProtKB-KW

    Keywords - Cellular componenti

    Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Endoplasmic reticulum, Golgi apparatus, Membrane, Microtubule

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi116 – 1161G → A: No processing of precursor. 1 Publication

    Organism-specific databases

    PharmGKBiPA28481.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 116116Gamma-aminobutyric acid receptor-associated protein-like 1PRO_0000212369Add
    BLAST
    Propeptidei117 – 1171Removed in mature formPRO_0000420208

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Lipidationi116 – 1161Phosphatidylethanolamine amidated glycine1 Publication

    Post-translational modificationi

    The precursor molecule is cleaved by ATG4B to form the cytosolic form, GABARAPL1-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, GABARAPL1-II By similarity. ATG4B also mediates the delipidation required for GABARAPL1 recycling when autophagosomes fuse with lysosomes (PubMed:20404487).By similarity1 Publication
    The Legionella effector RavZ is a deconjugating enzyme that produces an ATG8 product that would be resistant to reconjugation by the host machinery due to the cleavage of the reactive C-terminal glycine.1 Publication

    Keywords - PTMi

    Lipoprotein

    Proteomic databases

    MaxQBiQ9H0R8.
    PaxDbiQ9H0R8.
    PRIDEiQ9H0R8.

    PTM databases

    PhosphoSiteiQ9H0R8.

    Miscellaneous databases

    PMAP-CutDBQ9H0R8.

    Expressioni

    Tissue specificityi

    Ubiquitous. Expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta and skeletal muscle. Expressed at very low levels in thymus and small intestine. In the brain, expression is particularly intense in motoneurons in the embryo and in neurons involved in somatomotor and neuroendocrine functions in the adult, particularly in the substantia nigra pars compacta.3 Publications

    Gene expression databases

    ArrayExpressiQ9H0R8.
    BgeeiQ9H0R8.
    CleanExiHS_GABARAPL1.
    GenevestigatoriQ9H0R8.

    Organism-specific databases

    HPAiHPA051386.

    Interactioni

    Subunit structurei

    Interacts with GABRG2 and beta-tubulin By similarity. Interacts with ATG13, OPRK1, RB1CC1 and ULK1. Interacts with TP53INP1 and TP53INP2. Directly interacts with SQSTM1. Interacts with ATG3, ATG7 and MAP15. Interacts with TECPR2.By similarity6 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    ATG13O751432EBI-746969,EBI-2798775
    ATG2AQ2TAZ03EBI-746969,EBI-2514077
    ATG3Q9NT623EBI-746969,EBI-988094
    ATG4BQ9Y4P17EBI-746969,EBI-712014
    ATG7O953526EBI-746969,EBI-987834
    Bnip3lQ9Z2F74EBI-3464833,EBI-1774669From a different organism.
    CLINT1Q146772EBI-746969,EBI-1171113
    DYX1C1Q8WXU22EBI-746969,EBI-2946907
    FNIP1Q8TF402EBI-746969,EBI-2946919
    FYCO1Q9BQS82EBI-746969,EBI-2869338
    GBASO753236EBI-746969,EBI-307133
    HADHAP409394EBI-746969,EBI-356720
    HADHBP550844EBI-746969,EBI-356635
    IPO5O004104EBI-746969,EBI-356424
    KBTBD6Q86V974EBI-746969,EBI-2514778
    KBTBD7Q8WVZ93EBI-746969,EBI-473695
    NBR1Q145964EBI-746969,EBI-742698
    NCOA7Q8NI082EBI-746969,EBI-80799
    NEDD4P469346EBI-746969,EBI-726944
    NEK9Q8TD196EBI-746969,EBI-1044009
    NSMAFQ926366EBI-746969,EBI-2947053
    OPRK1P411455EBI-3464833,EBI-925028
    PRKAR1AP106442EBI-746969,EBI-476431
    RABGAP1Q9Y3P92EBI-746969,EBI-1057545
    RASSF5Q8WWW02EBI-746969,EBI-367390
    SAFB2Q141512EBI-746969,EBI-352869
    SQSTM1Q135017EBI-746969,EBI-307104
    STBD1O952107EBI-746969,EBI-2947137
    STK3Q131882EBI-746969,EBI-992580
    STK4Q130432EBI-746969,EBI-367376
    TBC1D15Q8TC072EBI-746969,EBI-1048247
    TBC1D2BQ9UPU75EBI-746969,EBI-2947180
    TECPR2O150402EBI-746969,EBI-2946991
    UBA5Q9GZZ92EBI-746969,EBI-747805
    ULK1O753852EBI-746969,EBI-908831

    Protein-protein interaction databases

    BioGridi117223. 59 interactions.
    IntActiQ9H0R8. 500 interactions.
    MINTiMINT-1456875.

    Structurei

    Secondary structure

    1
    117
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi4 – 85
    Helixi11 – 2414
    Beta strandi28 – 358
    Beta strandi48 – 525
    Helixi57 – 6711
    Beta strandi77 – 804
    Helixi91 – 988
    Beta strandi105 – 1106

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2L8JNMR-A2-115[»]
    2R2QX-ray1.65A/B3-111[»]
    ProteinModelPortaliQ9H0R8.
    SMRiQ9H0R8. Positions 3-111.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9H0R8.

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 2222Interaction with beta-tubulinBy similarityAdd
    BLAST
    Regioni36 – 6833Interaction with GABRG2By similarityAdd
    BLAST

    Sequence similaritiesi

    Belongs to the ATG8 family.Curated

    Phylogenomic databases

    eggNOGiNOG281408.
    HOGENOMiHOG000232034.
    HOVERGENiHBG051706.
    InParanoidiQ9H0R8.
    KOiK08341.
    OMAiSRIREKH.
    PhylomeDBiQ9H0R8.
    TreeFamiTF314556.

    Family and domain databases

    InterProiIPR004241. Atg8_like.
    IPR029071. Ubiquitin-rel_dom.
    [Graphical view]
    PANTHERiPTHR10969. PTHR10969. 1 hit.
    PfamiPF02991. Atg8. 1 hit.
    [Graphical view]
    SUPFAMiSSF54236. SSF54236. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9H0R8-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKFQYKEDHP FEYRKKEGEK IRKKYPDRVP VIVEKAPKAR VPDLDKRKYL    50
    VPSDLTVGQF YFLIRKRIHL RPEDALFFFV NNTIPPTSAT MGQLYEDNHE 100
    EDYFLYVAYS DESVYGK 117
    Length:117
    Mass (Da):14,044
    Last modified:March 1, 2001 - v1
    Checksum:i7F56E345255F564B
    GO
    Isoform 2 (identifier: Q9H0R8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         97-117: DNHEEDYFLYVAYSDESVYGK → VMVLVAQYWMPSSAVWHPLALVLDALITHLRSGAEGVIYPDPLTYGSVRL

    Show »
    Length:146
    Mass (Da):17,008
    Checksum:iFC0CDEB0EF8F4529
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei97 – 11721DNHEE…SVYGK → VMVLVAQYWMPSSAVWHPLA LVLDALITHLRSGAEGVIYP DPLTYGSVRL in isoform 2. 2 PublicationsVSP_044422Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF287012 mRNA. Translation: AAK55962.1.
    AF087847 mRNA. Translation: AAK20399.1.
    JN663881 mRNA. Translation: AEZ06294.1.
    AL136676 mRNA. Translation: CAB66611.1.
    AK303581 mRNA. Translation: BAG64599.1.
    CR533480 mRNA. Translation: CAG38511.1.
    AC115676 Genomic DNA. No translation available.
    CH471094 Genomic DNA. Translation: EAW96164.1.
    BC009309 mRNA. Translation: AAH09309.1.
    BC028315 mRNA. Translation: AAH28315.1.
    CCDSiCCDS8620.1. [Q9H0R8-1]
    RefSeqiNP_113600.1. NM_031412.2. [Q9H0R8-1]
    XP_005253401.1. XM_005253344.2. [Q9H0R8-2]
    UniGeneiHs.524250.

    Genome annotation databases

    EnsembliENST00000266458; ENSP00000266458; ENSG00000139112. [Q9H0R8-1]
    ENST00000421801; ENSP00000411256; ENSG00000139112. [Q9H0R8-2]
    ENST00000543602; ENSP00000445857; ENSG00000139112. [Q9H0R8-2]
    ENST00000545887; ENSP00000444186; ENSG00000139112. [Q9H0R8-1]
    GeneIDi23710.
    KEGGihsa:23710.
    UCSCiuc001qxs.3. human. [Q9H0R8-1]
    uc010shb.1. human. [Q9H0R8-2]

    Polymorphism databases

    DMDMi44887973.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF287012 mRNA. Translation: AAK55962.1 .
    AF087847 mRNA. Translation: AAK20399.1 .
    JN663881 mRNA. Translation: AEZ06294.1 .
    AL136676 mRNA. Translation: CAB66611.1 .
    AK303581 mRNA. Translation: BAG64599.1 .
    CR533480 mRNA. Translation: CAG38511.1 .
    AC115676 Genomic DNA. No translation available.
    CH471094 Genomic DNA. Translation: EAW96164.1 .
    BC009309 mRNA. Translation: AAH09309.1 .
    BC028315 mRNA. Translation: AAH28315.1 .
    CCDSi CCDS8620.1. [Q9H0R8-1 ]
    RefSeqi NP_113600.1. NM_031412.2. [Q9H0R8-1 ]
    XP_005253401.1. XM_005253344.2. [Q9H0R8-2 ]
    UniGenei Hs.524250.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2L8J NMR - A 2-115 [» ]
    2R2Q X-ray 1.65 A/B 3-111 [» ]
    ProteinModelPortali Q9H0R8.
    SMRi Q9H0R8. Positions 3-111.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 117223. 59 interactions.
    IntActi Q9H0R8. 500 interactions.
    MINTi MINT-1456875.

    PTM databases

    PhosphoSitei Q9H0R8.

    Polymorphism databases

    DMDMi 44887973.

    Proteomic databases

    MaxQBi Q9H0R8.
    PaxDbi Q9H0R8.
    PRIDEi Q9H0R8.

    Protocols and materials databases

    DNASUi 23710.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000266458 ; ENSP00000266458 ; ENSG00000139112 . [Q9H0R8-1 ]
    ENST00000421801 ; ENSP00000411256 ; ENSG00000139112 . [Q9H0R8-2 ]
    ENST00000543602 ; ENSP00000445857 ; ENSG00000139112 . [Q9H0R8-2 ]
    ENST00000545887 ; ENSP00000444186 ; ENSG00000139112 . [Q9H0R8-1 ]
    GeneIDi 23710.
    KEGGi hsa:23710.
    UCSCi uc001qxs.3. human. [Q9H0R8-1 ]
    uc010shb.1. human. [Q9H0R8-2 ]

    Organism-specific databases

    CTDi 23710.
    GeneCardsi GC12P010365.
    H-InvDB HIX0036758.
    HGNCi HGNC:4068. GABARAPL1.
    HPAi HPA051386.
    MIMi 607420. gene.
    neXtProti NX_Q9H0R8.
    PharmGKBi PA28481.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG281408.
    HOGENOMi HOG000232034.
    HOVERGENi HBG051706.
    InParanoidi Q9H0R8.
    KOi K08341.
    OMAi SRIREKH.
    PhylomeDBi Q9H0R8.
    TreeFami TF314556.

    Miscellaneous databases

    ChiTaRSi GABARAPL1. human.
    EvolutionaryTracei Q9H0R8.
    GenomeRNAii 23710.
    NextBioi 35476887.
    PMAP-CutDB Q9H0R8.
    PROi Q9H0R8.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9H0R8.
    Bgeei Q9H0R8.
    CleanExi HS_GABARAPL1.
    Genevestigatori Q9H0R8.

    Family and domain databases

    InterProi IPR004241. Atg8_like.
    IPR029071. Ubiquitin-rel_dom.
    [Graphical view ]
    PANTHERi PTHR10969. PTHR10969. 1 hit.
    Pfami PF02991. Atg8. 1 hit.
    [Graphical view ]
    SUPFAMi SSF54236. SSF54236. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
      Tissue: Placenta.
    2. "Cloning, expression patterns, and chromosome localization of three human and two mouse homologues of GABA(A) receptor-associated protein."
      Xin Y., Yu L., Chen Z., Zheng L., Fu Q., Jiang J., Zhang P., Gong R., Zhao S.
      Genomics 74:408-413(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    3. "Alternative splicing pattern analysis of human Atg8 family proteins."
      Liu C., Yu L.
      Submitted (SEP-2011) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Thymus.
    6. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    7. "The finished DNA sequence of human chromosome 12."
      Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
      , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
      Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain and Colon.
    10. "GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor."
      Chen C., Li J.-G., Chen Y., Huang P., Wang Y., Liu-Chen L.-Y.
      J. Biol. Chem. 281:7983-7993(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH OPRK1.
    11. "p62/SQSTM1 binds directly to Atg8/LC3 to facilitate degradation of ubiquitinated protein aggregates by autophagy."
      Pankiv S., Clausen T.H., Lamark T., Brech A., Bruun J.A., Outzen H., Overvatn A., Bjorkoy G., Johansen T.
      J. Biol. Chem. 282:24131-24145(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH SQSTM1, SUBCELLULAR LOCATION.
    12. Cited for: FUNCTION, SUBCELLULAR LOCATION, PROTEOLYTIC CLEAVAGE, LIPIDATION AT GLY-116, MUTAGENESIS OF GLY-116.
    13. "Network organization of the human autophagy system."
      Behrends C., Sowa M.E., Gygi S.P., Harper J.W.
      Nature 466:68-76(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH TECPR2.
    14. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    15. Cited for: INTERACTION WITH MAPK15.
    16. "ATG8 family proteins act as scaffolds for assembly of the ULK complex: sequence requirements for LC3-interacting region (LIR) motifs."
      Alemu E.A., Lamark T., Torgersen K.M., Birgisdottir A.B., Larsen K.B., Jain A., Olsvik H., Overvatn A., Kirkin V., Johansen T.
      J. Biol. Chem. 287:39275-39290(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH ATG13; RB1CC1 AND ULK1.
    17. "DOR/Tp53inp2 and Tp53inp1 constitute a metazoan gene family encoding dual regulators of autophagy and transcription."
      Sancho A., Duran J., Garcia-Espana A., Mauvezin C., Alemu E.A., Lamark T., Macias M.J., Desalle R., Royo M., Sala D., Chicote J.U., Palacin M., Johansen T., Zorzano A.
      PLoS ONE 7:E34034-E34034(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH TP53INP1 AND TP53INP2.
    18. "The Legionella effector RavZ inhibits host autophagy through irreversible Atg8 deconjugation."
      Choy A., Dancourt J., Mugo B., O'Connor T.J., Isberg R.R., Melia T.J., Roy C.R.
      Science 338:1072-1076(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: DECONJUGATION BY LEGIONELLA RAVZ.
    19. "Specific distribution of the autophagic protein GABARAPL1/GEC1 in the developing and adult mouse brain and identification of neuronal populations expressing GABARAPL1/GEC1."
      Le Grand J.N., Bon K., Fraichard A., Zhang J., Jouvenot M., Risold P.Y., Boyer-Guittaut M., Delage-Mourroux R.
      PLoS ONE 8:E63133-E63133(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    20. "Crystal structure of human gamma-aminobutyric acid receptor-associated protein-like 1 (GABARAP1)."
      Structural genomics consortium (SGC)
      Submitted (SEP-2007) to the PDB data bank
      Cited for: X-RAY CRYSTALLOGRAPHY (1.65 ANGSTROMS) OF 3-111.

    Entry informationi

    Entry nameiGBRL1_HUMAN
    AccessioniPrimary (citable) accession number: Q9H0R8
    Secondary accession number(s): B4E0Y7, Q6FIE6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 1, 2004
    Last sequence update: March 1, 2001
    Last modified: October 1, 2014
    This is version 121 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3