Q9H0P0 (5NT3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 98.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cytosolic 5'-nucleotidase 3 EC=3.1.3.5 Alternative name(s): Cytosolic 5'-nucleotidase III Short name=cN-III Pyrimidine 5'-nucleotidase 1 Short name=P5'N-1 Short name=P5N-1 Short name=PN-I Uridine 5'-monophosphate hydrolase 1 p36 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 336 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Can act both as nucleotidase and as phosphotransferase. |
| Catalytic activity | A 5'-ribonucleotide + H2O = a ribonucleoside + phosphate. |
| Subunit structure | Monomer. Ref.12 |
| Subcellular location | Isoform 2: Endoplasmic reticulum Ref.11. |
| Tissue specificity | Isoform 1 and isoform 3 are expressed in reticulocytes and lymphocytes. Isoform 4 is expressed only in reticulocytes. Ref.2 Ref.3 |
| Induction | Isoform 2 is induced by interferon alpha in Raji cells in association with lupus inclusions. Ref.11 |
| Involvement in disease | Defects in NT5C3 are the cause of P5N deficiency (P5ND) [MIM:266120]; also called hemolytic anemia due to P5N deficiency or hemolytic anemia due to UMPH1 deficiency. P5ND is an autosomal recessive condition causing hemolytic anemia characterized by marked basophilic stipplig and the accumulation of high concentrations of pyrimidine nucleotides within the erythrocyte. It is implicated in the anemia of lead poisoning and is possibly associated with learning difficulties. |
| Sequence similarities | Belongs to the pyrimidine 5'-nucleotidase family. |
| Biophysicochemical properties | Kinetic parameters: KM=66 µM for CMP Ref.12 |
| Sequence caution | The sequence AAF36153.1 differs from that shown. Reason: Erroneous initiation. The sequence AAG33630.1 differs from that shown. Reason: Frameshift at several positions. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 (identifier: Q9H0P0-4) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: Q9H0P0-1) The sequence of this isoform differs from the canonical sequence as follows: 1-50: MRAPSMDRAAVARVGAVASASVCALVAGVVLAQYIFTLKRKTGRKTKIIE → MTNQESAVHVK | ||||||
| Isoform 3 (identifier: Q9H0P0-2) The sequence of this isoform differs from the canonical sequence as follows: 1-50: Missing. | ||||||
| Isoform 4 (identifier: Q9H0P0-3) Also known as: P5N-R; The sequence of this isoform differs from the canonical sequence as follows: 1-51: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 336 | 336 | Cytosolic 5'-nucleotidase 3 | PRO_0000064387 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 203 – 204 | 2 | Substrate binding | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 88 | 1 | Nucleophile | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 90 | 1 | Proton donor | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 88 | 1 | Magnesium | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 90 | 1 | Magnesium; via carbonyl oxygen | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 277 | 1 | Magnesium | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 252 | 1 | Substrate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 51 | 51 | Missing in isoform 4. | VSP_015624 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 50 | 50 | MRAPS…TKIIE → MTNQESAVHVK in isoform 1. | VSP_021565 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 50 | 50 | Missing in isoform 3. | VSP_015623 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 137 | 1 | D → V in P5N deficiency; may alter protein structure. Ref.2 Ref.12 | VAR_023511 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 181 | 1 | L → P in P5N deficiency; may alter protein structure and markedly decreases activity. Ref.3 Ref.12 | VAR_023512 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 229 | 1 | N → S in P5N deficiency; markedly decreases activity. Ref.12 Ref.15 | VAR_023513 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 280 | 1 | G → R in P5N deficiency; markedly decreases activity. Ref.3 Ref.12 | VAR_023514 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 88 | 1 | D → N: Loss of nucleotidase and phosphotransferase activity. Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 89 | 1 | F → A: Increases Km for CMP 45-fold. Reduces nucleotidase and phosphotransferase activity by 99%. Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 90 | 1 | D → N: Loss of nucleotidase and phosphotransferase activity. Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 135 | 1 | E → D: No effect on nucleotidase activity. Reduces phosphotransferase activity by 99%. Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 233 | 1 | F → A: Reduces nucleotidase and phosphotransferase activity by 97%. Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 95 | 1 | R → K AA sequence Ref.11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 144 | 1 | E → Q AA sequence Ref.11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 329 | 1 | N → R AA sequence Ref.11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 65 – 78 | 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 80 – 82 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 83 – 87 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 90 – 93 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 96 – 98 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 106 – 111 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 118 – 135 | 18 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 138 – 140 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 142 – 162 | 21 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 167 – 169 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 170 – 175 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 185 – 193 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 194 – 196 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 199 – 206 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 207 – 216 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 224 – 229 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 231 – 233 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 237 – 242 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 252 – 257 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 260 – 264 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 265 – 268 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 271 – 279 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 280 – 283 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 284 – 287 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 292 – 300 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 304 – 312 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 315 – 320 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 326 – 335 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human erythrocyte pyrimidine 5'-nucleotidase, PN-I, is identical to p36, a protein associated to lupus inclusion formation in response to alpha-interferon." Amici A., Emanuelli M., Raffaelli N., Ruggieri S., Saccucci F., Magni G. Blood 96:1596-1598(2000) [PubMed: 10942414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), PARTIAL PROTEIN SEQUENCE. Tissue: Placenta. |
| [2] | "Genetic basis of hemolytic anemia caused by pyrimidine 5' nucleotidase deficiency." Marinaki A.M., Escuredo E., Duley J.A., Simmonds H.A., Amici A., Naponelli V., Magni G., Seip M., Ben-Bassat I., Harley E.H., Thein S.L., Rees D.C. Blood 97:3327-3332(2001) [PubMed: 11369620] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), TISSUE SPECIFICITY, VARIANT P5N DEFICIENCY VAL-137. |
| [3] | "Molecular basis of Japanese variants of pyrimidine 5'-nucleotidase deficiency." Kanno H., Takizawa T., Miwa S., Fujii H. Br. J. Haematol. 126:265-271(2004) [PubMed: 15238149] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), TISSUE SPECIFICITY, VARIANTS P5N DEFICIENCY PRO-181 AND ARG-280, CHARACTERIZATION OF VARIANTS P5N DEFICIENCY PRO-181 AND ARG-280. |
| [4] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed: 11230166] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Kidney. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Tissue: Brain cortex and Thalamus. |
| [6] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [7] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed: 12853948] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain, Lung, Muscle and Prostate. |
| [10] | "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells." Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. Chen Z.Genome Res. 10:1546-1560(2000) [PubMed: 11042152] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 29-336 (ISOFORM 2). Tissue: Umbilical cord blood. |
| [11] | "Purification, microsequencing, and immunolocalization of p36, a new interferon-alpha-induced protein that is associated with human lupus inclusions." Rich S.A., Bose M., Tempst P., Rudofsky U.H. J. Biol. Chem. 271:1118-1126(1996) [PubMed: 8557639] [Abstract] Cited for: PROTEIN SEQUENCE OF 83-95; 131-147; 226-240; 268-296 AND 311-329, INDUCTION, SUBCELLULAR LOCATION. |
| [12] | "Evidence for essential catalytic determinants for human erythrocyte pyrimidine 5'-nucleotidase." Amici A., Ciccioli K., Naponelli V., Raffaelli N., Magni G. Cell. Mol. Life Sci. 62:1613-1620(2005) [PubMed: 15968458] [Abstract] Cited for: PROTEIN SEQUENCE OF 1-11, SUBUNIT, BIOPHYSICOCHEMICAL PROPERTIES, CHARACTERIZATION OF VARIANTS P5N DEFICIENCY VAL-137; PRO-181; SER-229 AND ARG-280, MUTAGENESIS OF ASP-88; PHE-89; ASP-90; GLU-135 AND PHE-233. |
| [13] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [14] | "Crystal structure of human cytosolic 5'-nucleotidase II: insights into allosteric regulation and substrate recognition." Wallden K., Stenmark P., Nyman T., Flodin S., Graeslund S., Loppnau P., Bianchi V., Nordlund P. J. Biol. Chem. 282:17828-17836(2007) [PubMed: 17405878] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.67 ANGSTROMS) OF 64-336 IN COMPLEX WITH PHOSPHATE AND MAGNESIUM IONS. |
| [15] | "Molecular characterization of six unrelated Italian patients affected by pyrimidine 5'-nucleotidase deficiency." Bianchi P., Fermo E., Alfinito F., Vercellati C., Baserga M., Ferraro F., Guzzo I., Rotoli B., Zanella A. Br. J. Haematol. 122:847-851(2003) [PubMed: 12930399] [Abstract] Cited for: VARIANT P5N DEFICIENCY SER-229. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF312735 mRNA. Translation: AAG33630.1. Sequence problems. AL136716 mRNA. Translation: CAB66650.1. AK290118 mRNA. Translation: BAF82807.1. AK314109 mRNA. Translation: BAG36802.1. CR533518 mRNA. Translation: CAG38549.1. AC074338 Genomic DNA. No translation available. AC083863 Genomic DNA. No translation available. CH471073 Genomic DNA. Translation: EAW94007.1. CH471073 Genomic DNA. Translation: EAW94008.1. BC013292 mRNA. Translation: AAH13292.2. BC015856 mRNA. Translation: AAH15856.2. BC066914 mRNA. Translation: AAH66914.1. BC071652 mRNA. Translation: AAH71652.2. AF151067 mRNA. Translation: AAF36153.1. Different initiation. | ||||||||||||||||||||||||
| IPI | IPI00100192. IPI00619911. IPI00647805. IPI00807412. | ||||||||||||||||||||||||
| RefSeq | NP_001002010.1. NM_001002010.1. NP_001159590.1. NM_001166118.1. NP_057573.2. NM_016489.11. | ||||||||||||||||||||||||
| UniGene | Hs.487933. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | Q9H0P0. | ||||||||||||||||||||||||
| SMR | Q9H0P0. Positions 64-336. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| IntAct | Q9H0P0. 3 interactions. | ||||||||||||||||||||||||
| STRING | Q9H0P0. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q9H0P0. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 117949804. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PRIDE | Q9H0P0. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000242210; ENSP00000242210; ENSG00000122643. | ||||||||||||||||||||||||
| GeneID | 51251. | ||||||||||||||||||||||||
| KEGG | hsa:51251. | ||||||||||||||||||||||||
| UCSC | uc003tdi.1. human. uc003tdk.1. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 51251. | ||||||||||||||||||||||||
| GeneCards | GC07M033053. | ||||||||||||||||||||||||
| HGNC | HGNC:17820. NT5C3. | ||||||||||||||||||||||||
| HPA | HPA029058. | ||||||||||||||||||||||||
| MIM | 266120. phenotype. 606224. gene. | ||||||||||||||||||||||||
| neXtProt | NX_Q9H0P0. | ||||||||||||||||||||||||
| Orphanet | 35120. Hemolytic anemia due to pyrimidine 5' nucleotidase deficiency. | ||||||||||||||||||||||||
| PharmGKB | PA31802. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | prNOG16635. | ||||||||||||||||||||||||
| GeneTree | ENSGT00390000012959. | ||||||||||||||||||||||||
| HOVERGEN | HBG059750. | ||||||||||||||||||||||||
| InParanoid | Q9H0P0. | ||||||||||||||||||||||||
| OMA | NTEYFKQ. | ||||||||||||||||||||||||
| PhylomeDB | Q9H0P0. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| Reactome | REACT_111217. Metabolism. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q9H0P0. | ||||||||||||||||||||||||
| Bgee | Q9H0P0. | ||||||||||||||||||||||||
| Genevestigator | Q9H0P0. | ||||||||||||||||||||||||
| GermOnline | ENSG00000122643. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR023214. HAD-like_dom. IPR006434. Pyrimidine_nucleotidase_eu. [Graphical view] | ||||||||||||||||||||||||
| Gene3D | G3DSA:3.40.50.1000. HAD-like_dom. 1 hit. | ||||||||||||||||||||||||
| KO | K01081. | ||||||||||||||||||||||||
| PANTHER | PTHR13045. HAD-SF_hydro_IE. 1 hit. | ||||||||||||||||||||||||
| Pfam | PF05822. UMPH-1. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SUPFAM | SSF56784. HAD-like_dom. 1 hit. | ||||||||||||||||||||||||
| TIGRFAMs | TIGR01544. HAD-SF-IE. 1 hit. | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| NextBio | 54391. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | 5NT3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H0P0 Secondary accession number(s): A8K253 Q9UC45 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with