Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9H0P0

- 5NT3A_HUMAN

UniProt

Q9H0P0 - 5NT3A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Cytosolic 5'-nucleotidase 3A

Gene

NT5C3A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Can act both as nucleotidase and as phosphotransferase.

Catalytic activityi

A 5'-ribonucleotide + H2O = a ribonucleoside + phosphate.

Kineticsi

  1. KM=66 µM for CMP1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei88 – 881Nucleophile
Metal bindingi88 – 881Magnesium
Active sitei90 – 901Proton donor
Metal bindingi90 – 901Magnesium; via carbonyl oxygen
Binding sitei252 – 2521Substrate
Metal bindingi277 – 2771Magnesium

GO - Molecular functioni

  1. 2'-phosphotransferase activity Source: UniProtKB
  2. 5'-nucleotidase activity Source: UniProtKB
  3. magnesium ion binding Source: UniProtKB
  4. nucleotide binding Source: UniProtKB-KW

GO - Biological processi

  1. dephosphorylation Source: GOC
  2. nucleobase-containing small molecule metabolic process Source: Reactome
  3. nucleotide metabolic process Source: UniProtKB-KW
  4. pyrimidine nucleobase metabolic process Source: Reactome
  5. pyrimidine nucleoside catabolic process Source: Reactome
  6. pyrimidine nucleoside metabolic process Source: UniProtKB
  7. small molecule metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Transferase

Keywords - Biological processi

Nucleotide metabolism

Keywords - Ligandi

Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_1023. Pyrimidine catabolism.
SABIO-RKQ9H0P0.

Names & Taxonomyi

Protein namesi
Recommended name:
Cytosolic 5'-nucleotidase 3A (EC:3.1.3.5)
Alternative name(s):
Cytosolic 5'-nucleotidase 3
Cytosolic 5'-nucleotidase III
Short name:
cN-III
Pyrimidine 5'-nucleotidase 1
Short name:
P5'N-1
Short name:
P5N-1
Short name:
PN-I
Uridine 5'-monophosphate hydrolase 1
p36
Gene namesi
Name:NT5C3A
Synonyms:NT5C3, P5N1, UMPH1
ORF Names:HSPC233
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:17820. NT5C3A.

Subcellular locationi

Cytoplasm Curated

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. cytosol Source: Reactome
  3. endoplasmic reticulum Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum

Pathology & Biotechi

Involvement in diseasei

P5N deficiency (P5ND) [MIM:266120]: Autosomal recessive condition causing hemolytic anemia characterized by marked basophilic stippling and the accumulation of high concentrations of pyrimidine nucleotides within the erythrocyte. It is implicated in the anemia of lead poisoning and is possibly associated with learning difficulties.3 Publications
Note: The disease is caused by mutations affecting the gene represented in this entry.

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi88 – 881D → N: Loss of nucleotidase and phosphotransferase activity. 1 Publication
Mutagenesisi89 – 891F → A: Increases Km for CMP 45-fold. Reduces nucleotidase and phosphotransferase activity by 99%. 1 Publication
Mutagenesisi90 – 901D → N: Loss of nucleotidase and phosphotransferase activity. 1 Publication
Mutagenesisi135 – 1351E → D: No effect on nucleotidase activity. Reduces phosphotransferase activity by 99%. 1 Publication
Mutagenesisi233 – 2331F → A: Reduces nucleotidase and phosphotransferase activity by 97%. 1 Publication

Keywords - Diseasei

Disease mutation

Organism-specific databases

MIMi266120. phenotype.
Orphaneti35120. Hemolytic anemia due to pyrimidine 5' nucleotidase deficiency.
PharmGKBiPA31802.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 336336Cytosolic 5'-nucleotidase 3APRO_0000064387Add
BLAST

Proteomic databases

MaxQBiQ9H0P0.
PaxDbiQ9H0P0.
PRIDEiQ9H0P0.

PTM databases

PhosphoSiteiQ9H0P0.

Expressioni

Tissue specificityi

Isoform 1 and isoform 3 are expressed in reticulocytes and lymphocytes. Isoform 4 is expressed only in reticulocytes.2 Publications

Inductioni

Isoform 2 is induced by interferon alpha in Raji cells in association with lupus inclusions.1 Publication

Gene expression databases

BgeeiQ9H0P0.
ExpressionAtlasiQ9H0P0. baseline.
GenevestigatoriQ9H0P0.

Organism-specific databases

HPAiHPA029058.

Interactioni

Subunit structurei

Monomer.2 Publications

Protein-protein interaction databases

BioGridi119408. 8 interactions.
IntActiQ9H0P0. 3 interactions.
MINTiMINT-3065844.

Structurei

Secondary structure

1
336
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi65 – 7814
Helixi80 – 823
Beta strandi83 – 875
Turni90 – 923
Beta strandi96 – 983
Helixi106 – 1116
Helixi118 – 13518
Beta strandi138 – 1403
Helixi142 – 16322
Helixi167 – 1693
Helixi170 – 1756
Helixi185 – 19410
Beta strandi199 – 2068
Helixi207 – 21610
Beta strandi224 – 2296
Beta strandi231 – 2333
Beta strandi237 – 2426
Helixi252 – 2587
Helixi260 – 2645
Turni265 – 2684
Beta strandi271 – 2799
Helixi280 – 2834
Turni284 – 2874
Beta strandi292 – 3009
Helixi304 – 3129
Beta strandi315 – 3206
Helixi326 – 33510

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2CN1X-ray2.67A64-336[»]
2JGAX-ray3.01A64-336[»]
2VKQX-ray2.50A64-336[»]
ProteinModelPortaliQ9H0P0.
SMRiQ9H0P0. Positions 64-336.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9H0P0.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni203 – 2042Substrate binding

Sequence similaritiesi

Belongs to the pyrimidine 5'-nucleotidase family.Curated

Phylogenomic databases

eggNOGiNOG266578.
GeneTreeiENSGT00390000012959.
HOVERGENiHBG059750.
KOiK01081.
OMAiNTEYFKQ.
PhylomeDBiQ9H0P0.
TreeFamiTF314663.

Family and domain databases

Gene3Di3.40.50.1000. 2 hits.
InterProiIPR023214. HAD-like_dom.
IPR006434. Pyrimidine_nucleotidase_eu.
[Graphical view]
PANTHERiPTHR13045. PTHR13045. 1 hit.
PfamiPF05822. UMPH-1. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.
TIGRFAMsiTIGR01544. HAD-SF-IE. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 2 (identifier: Q9H0P0-4) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRAPSMDRAA VARVGAVASA SVCALVAGVV LAQYIFTLKR KTGRKTKIIE
60 70 80 90 100
MMPEFQKSSV RIKNPTRVEE IICGLIKGGA AKLQIITDFD MTLSRFSYKG
110 120 130 140 150
KRCPTCHNII DNCKLVTDEC RKKLLQLKEK YYAIEVDPVL TVEEKYPYMV
160 170 180 190 200
EWYTKSHGLL VQQALPKAKL KEIVAESDVM LKEGYENFFD KLQQHSIPVF
210 220 230 240 250
IFSAGIGDVL EEVIRQAGVY HPNVKVVSNF MDFDETGVLK GFKGELIHVF
260 270 280 290 300
NKHDGALRNT EYFNQLKDNS NIILLGDSQG DLRMADGVAN VEHILKIGYL
310 320 330
NDRVDELLEK YMDSYDIVLV QDESLEVANS ILQKIL
Length:336
Mass (Da):37,948
Last modified:November 14, 2006 - v3
Checksum:iC5D75CCF1BB61021
GO
Isoform 1 (identifier: Q9H0P0-1) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MRAPSMDRAAVARVGAVASASVCALVAGVVLAQYIFTLKRKTGRKTKIIE → MTNQESAVHVK

Show »
Length:297
Mass (Da):33,915
Checksum:iFB91A66DD2273598
GO
Isoform 3 (identifier: Q9H0P0-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: Missing.

Show »
Length:286
Mass (Da):32,690
Checksum:i29313E2790194ED9
GO
Isoform 4 (identifier: Q9H0P0-3) [UniParc]FASTAAdd to Basket

Also known as: P5N-R

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: Missing.

Show »
Length:285
Mass (Da):32,559
Checksum:iCB3B6812C90A5578
GO

Sequence cautioni

The sequence AAG33630.1 differs from that shown. Reason: Frameshift at several positions.
The sequence AAF36153.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti95 – 951R → K AA sequence (PubMed:8557639)Curated
Sequence conflicti144 – 1441E → Q AA sequence (PubMed:8557639)Curated
Sequence conflicti329 – 3291N → R AA sequence (PubMed:8557639)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti137 – 1371D → V in P5N deficiency; may alter protein structure. 1 Publication
VAR_023511
Natural varianti181 – 1811L → P in P5N deficiency; may alter protein structure and markedly decreases activity. 1 Publication
VAR_023512
Natural varianti229 – 2291N → S in P5N deficiency; markedly decreases activity. 1 Publication
VAR_023513
Natural varianti280 – 2801G → R in P5N deficiency; markedly decreases activity. 1 Publication
VAR_023514

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5151Missing in isoform 4. 1 PublicationVSP_015624Add
BLAST
Alternative sequencei1 – 5050MRAPS…TKIIE → MTNQESAVHVK in isoform 1. 2 PublicationsVSP_021565Add
BLAST
Alternative sequencei1 – 5050Missing in isoform 3. 2 PublicationsVSP_015623Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF312735 mRNA. Translation: AAG33630.1. Sequence problems.
AL136716 mRNA. Translation: CAB66650.1.
AK290118 mRNA. Translation: BAF82807.1.
AK314109 mRNA. Translation: BAG36802.1.
CR533518 mRNA. Translation: CAG38549.1.
AC074338 Genomic DNA. No translation available.
AC083863 Genomic DNA. No translation available.
CH471073 Genomic DNA. Translation: EAW94007.1.
CH471073 Genomic DNA. Translation: EAW94008.1.
BC013292 mRNA. Translation: AAH13292.2.
BC015856 mRNA. Translation: AAH15856.2.
BC066914 mRNA. Translation: AAH66914.1.
BC071652 mRNA. Translation: AAH71652.2.
AF151067 mRNA. Translation: AAF36153.1. Different initiation.
CCDSiCCDS34616.1. [Q9H0P0-4]
CCDS34617.1. [Q9H0P0-1]
CCDS55101.1. [Q9H0P0-3]
RefSeqiNP_001002009.1. NM_001002009.2. [Q9H0P0-1]
NP_001002010.1. NM_001002010.2. [Q9H0P0-4]
NP_001159590.1. NM_001166118.2. [Q9H0P0-3]
NP_057573.2. NM_016489.12. [Q9H0P0-1]
UniGeneiHs.487933.

Genome annotation databases

EnsembliENST00000242210; ENSP00000242210; ENSG00000122643. [Q9H0P0-4]
ENST00000381626; ENSP00000371039; ENSG00000122643. [Q9H0P0-3]
ENST00000396152; ENSP00000379456; ENSG00000122643. [Q9H0P0-1]
ENST00000405342; ENSP00000385261; ENSG00000122643. [Q9H0P0-1]
ENST00000409467; ENSP00000387166; ENSG00000122643. [Q9H0P0-3]
ENST00000620705; ENSP00000484415; ENSG00000122643. [Q9H0P0-4]
GeneIDi51251.
KEGGihsa:51251.
UCSCiuc003tdi.4. human. [Q9H0P0-1]
uc003tdk.4. human. [Q9H0P0-4]

Polymorphism databases

DMDMi117949804.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF312735 mRNA. Translation: AAG33630.1 . Sequence problems.
AL136716 mRNA. Translation: CAB66650.1 .
AK290118 mRNA. Translation: BAF82807.1 .
AK314109 mRNA. Translation: BAG36802.1 .
CR533518 mRNA. Translation: CAG38549.1 .
AC074338 Genomic DNA. No translation available.
AC083863 Genomic DNA. No translation available.
CH471073 Genomic DNA. Translation: EAW94007.1 .
CH471073 Genomic DNA. Translation: EAW94008.1 .
BC013292 mRNA. Translation: AAH13292.2 .
BC015856 mRNA. Translation: AAH15856.2 .
BC066914 mRNA. Translation: AAH66914.1 .
BC071652 mRNA. Translation: AAH71652.2 .
AF151067 mRNA. Translation: AAF36153.1 . Different initiation.
CCDSi CCDS34616.1. [Q9H0P0-4 ]
CCDS34617.1. [Q9H0P0-1 ]
CCDS55101.1. [Q9H0P0-3 ]
RefSeqi NP_001002009.1. NM_001002009.2. [Q9H0P0-1 ]
NP_001002010.1. NM_001002010.2. [Q9H0P0-4 ]
NP_001159590.1. NM_001166118.2. [Q9H0P0-3 ]
NP_057573.2. NM_016489.12. [Q9H0P0-1 ]
UniGenei Hs.487933.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2CN1 X-ray 2.67 A 64-336 [» ]
2JGA X-ray 3.01 A 64-336 [» ]
2VKQ X-ray 2.50 A 64-336 [» ]
ProteinModelPortali Q9H0P0.
SMRi Q9H0P0. Positions 64-336.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119408. 8 interactions.
IntActi Q9H0P0. 3 interactions.
MINTi MINT-3065844.

PTM databases

PhosphoSitei Q9H0P0.

Polymorphism databases

DMDMi 117949804.

Proteomic databases

MaxQBi Q9H0P0.
PaxDbi Q9H0P0.
PRIDEi Q9H0P0.

Protocols and materials databases

DNASUi 51251.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000242210 ; ENSP00000242210 ; ENSG00000122643 . [Q9H0P0-4 ]
ENST00000381626 ; ENSP00000371039 ; ENSG00000122643 . [Q9H0P0-3 ]
ENST00000396152 ; ENSP00000379456 ; ENSG00000122643 . [Q9H0P0-1 ]
ENST00000405342 ; ENSP00000385261 ; ENSG00000122643 . [Q9H0P0-1 ]
ENST00000409467 ; ENSP00000387166 ; ENSG00000122643 . [Q9H0P0-3 ]
ENST00000620705 ; ENSP00000484415 ; ENSG00000122643 . [Q9H0P0-4 ]
GeneIDi 51251.
KEGGi hsa:51251.
UCSCi uc003tdi.4. human. [Q9H0P0-1 ]
uc003tdk.4. human. [Q9H0P0-4 ]

Organism-specific databases

CTDi 51251.
GeneCardsi GC07M033056.
HGNCi HGNC:17820. NT5C3A.
HPAi HPA029058.
MIMi 266120. phenotype.
606224. gene.
neXtProti NX_Q9H0P0.
Orphaneti 35120. Hemolytic anemia due to pyrimidine 5' nucleotidase deficiency.
PharmGKBi PA31802.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG266578.
GeneTreei ENSGT00390000012959.
HOVERGENi HBG059750.
KOi K01081.
OMAi NTEYFKQ.
PhylomeDBi Q9H0P0.
TreeFami TF314663.

Enzyme and pathway databases

Reactomei REACT_1023. Pyrimidine catabolism.
SABIO-RK Q9H0P0.

Miscellaneous databases

EvolutionaryTracei Q9H0P0.
GeneWikii NT5C3.
GenomeRNAii 51251.
NextBioi 54391.
PROi Q9H0P0.
SOURCEi Search...

Gene expression databases

Bgeei Q9H0P0.
ExpressionAtlasi Q9H0P0. baseline.
Genevestigatori Q9H0P0.

Family and domain databases

Gene3Di 3.40.50.1000. 2 hits.
InterProi IPR023214. HAD-like_dom.
IPR006434. Pyrimidine_nucleotidase_eu.
[Graphical view ]
PANTHERi PTHR13045. PTHR13045. 1 hit.
Pfami PF05822. UMPH-1. 1 hit.
[Graphical view ]
SUPFAMi SSF56784. SSF56784. 1 hit.
TIGRFAMsi TIGR01544. HAD-SF-IE. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Human erythrocyte pyrimidine 5'-nucleotidase, PN-I, is identical to p36, a protein associated to lupus inclusion formation in response to alpha-interferon."
    Amici A., Emanuelli M., Raffaelli N., Ruggieri S., Saccucci F., Magni G.
    Blood 96:1596-1598(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), PARTIAL PROTEIN SEQUENCE.
    Tissue: Placenta.
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), TISSUE SPECIFICITY, VARIANT P5N DEFICIENCY VAL-137.
  3. "Molecular basis of Japanese variants of pyrimidine 5'-nucleotidase deficiency."
    Kanno H., Takizawa T., Miwa S., Fujii H.
    Br. J. Haematol. 126:265-271(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), TISSUE SPECIFICITY, VARIANTS P5N DEFICIENCY PRO-181 AND ARG-280, CHARACTERIZATION OF VARIANTS P5N DEFICIENCY PRO-181 AND ARG-280.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Kidney.
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Brain cortex and Thalamus.
  6. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  7. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain, Lung, Muscle and Prostate.
  10. "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
    Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X.
    , Gu J., Chen S.-J., Chen Z.
    Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 29-336 (ISOFORM 2).
    Tissue: Umbilical cord blood.
  11. "Purification, microsequencing, and immunolocalization of p36, a new interferon-alpha-induced protein that is associated with human lupus inclusions."
    Rich S.A., Bose M., Tempst P., Rudofsky U.H.
    J. Biol. Chem. 271:1118-1126(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 83-95; 131-147; 226-240; 268-296 AND 311-329, INDUCTION, SUBCELLULAR LOCATION.
  12. "Evidence for essential catalytic determinants for human erythrocyte pyrimidine 5'-nucleotidase."
    Amici A., Ciccioli K., Naponelli V., Raffaelli N., Magni G.
    Cell. Mol. Life Sci. 62:1613-1620(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 1-11, SUBUNIT, BIOPHYSICOCHEMICAL PROPERTIES, CHARACTERIZATION OF VARIANTS P5N DEFICIENCY VAL-137; PRO-181; SER-229 AND ARG-280, MUTAGENESIS OF ASP-88; PHE-89; ASP-90; GLU-135 AND PHE-233.
  13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  14. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  15. "Crystal structure of human cytosolic 5'-nucleotidase II: insights into allosteric regulation and substrate recognition."
    Wallden K., Stenmark P., Nyman T., Flodin S., Graeslund S., Loppnau P., Bianchi V., Nordlund P.
    J. Biol. Chem. 282:17828-17836(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.67 ANGSTROMS) OF 64-336 IN COMPLEX WITH PHOSPHATE AND MAGNESIUM IONS.
  16. "Molecular characterization of six unrelated Italian patients affected by pyrimidine 5'-nucleotidase deficiency."
    Bianchi P., Fermo E., Alfinito F., Vercellati C., Baserga M., Ferraro F., Guzzo I., Rotoli B., Zanella A.
    Br. J. Haematol. 122:847-851(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT P5N DEFICIENCY SER-229.

Entry informationi

Entry namei5NT3A_HUMAN
AccessioniPrimary (citable) accession number: Q9H0P0
Secondary accession number(s): A8K253
, B2RAA5, B8ZZC4, Q6IPZ1, Q6NXS6, Q7L3G6, Q9P0P5, Q9UC42, Q9UC43, Q9UC44, Q9UC45
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 13, 2005
Last sequence update: November 14, 2006
Last modified: October 29, 2014
This is version 126 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3