Q9H0I2 (ENKD1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 82.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Enkurin domain-containing protein 1 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 346 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Sequence similarities | Contains 1 enkurin domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | cytoplasmic microtubule Inferred from direct assay PubMed 23264731. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9H0I2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9H0I2-2) The sequence of this isoform differs from the canonical sequence as follows: 1-118: Missing. 119-149: ERSREQGQPRPLKALWRSPKYDKVESRVKAQ → MDAKVRRAKMARVLQLEPQTSACLLSLLCPA | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 346 | 346 | Enkurin domain-containing protein 1 | PRO_0000265931 | |||||
Regions | |||||||||
| Domain | 251 – 343 | 93 | Enkurin | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 118 | 118 | Missing in isoform 2. | VSP_021904 | |||||
| Alternative sequence | 119 – 149 | 31 | ERSRE…RVKAQ → MDAKVRRAKMARVLQLEPQT SACLLSLLCPA in isoform 2. | VSP_021905 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [2] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Placenta. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AL136786 mRNA. Translation: CAB66720.1. AY358834 mRNA. Translation: AAQ89193.1. BC008284 mRNA. Translation: AAH08284.1. |
| IPI | IPI00030272. IPI00816822. |
| RefSeq | NP_115516.1. NM_032140.1. |
| UniGene | Hs.729159. |
3D structure databases | |
| ProteinModelPortal | Q9H0I2. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9H0I2. 16 interactions. |
| STRING | 9606.ENSP00000243878. |
PTM databases | |
| PhosphoSite | Q9H0I2. |
Polymorphism databases | |
| DMDM | 74752565. |
Proteomic databases | |
| PaxDb | Q9H0I2. |
| PRIDE | Q9H0I2. |
Protocols and materials databases | |
| DNASU | 84080. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000243878; ENSP00000243878; ENSG00000124074. |
| GeneID | 84080. |
| KEGG | hsa:84080. |
| UCSC | uc002etv.1. human. uc002etw.1. human. |
Organism-specific databases | |
| CTD | 84080. |
| GeneCards | GC16M067696. |
| H-InvDB | HIX0013154. |
| HGNC | HGNC:25246. ENKD1. |
| HPA | HPA041163. HPA041478. |
| neXtProt | NX_Q9H0I2. |
| PharmGKB | PA142672256. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG86873. |
| HOGENOM | HOG000007786. |
| HOVERGEN | HBG081309. |
| InParanoid | Q9H0I2. |
| OMA | CPDYYRR. |
| OrthoDB | EOG4FR0S7. |
| PhylomeDB | Q9H0I2. |
Gene expression databases | |
| Bgee | Q9H0I2. |
| CleanEx | HS_C16orf48. |
| Genevestigator | Q9H0I2. |
| GermOnline | ENSG00000124074. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR027012. Enkurin-like_dom. [Graphical view] |
| Pfam | PF13864. Enkurin. 1 hit. [Graphical view] |
| PROSITE | PS51665. ENKURIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | C16orf48. human. |
| GenomeRNAi | 84080. |
| NextBio | 73303. |
Entry information
| Entry name | ENKD1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H0I2 Secondary accession number(s): Q6UWD7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
