SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9H0I2

- ENKD1_HUMAN

UniProt

Q9H0I2 - ENKD1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Enkurin domain-containing protein 1

Gene
ENKD1, C16orf48, UNQ6410/PRO21183
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5 - Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Enkurin domain-containing protein 1
Gene namesi
Name:ENKD1
Synonyms:C16orf48
ORF Names:UNQ6410/PRO21183
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 16

Organism-specific databases

HGNCiHGNC:25246. ENKD1.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasmic microtubule Source: UniProtKB
  2. microtubule cytoskeleton Source: LIFEdb
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142672256.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 346346Enkurin domain-containing protein 1PRO_0000265931Add
BLAST

Proteomic databases

MaxQBiQ9H0I2.
PaxDbiQ9H0I2.
PRIDEiQ9H0I2.

PTM databases

PhosphoSiteiQ9H0I2.

Expressioni

Gene expression databases

BgeeiQ9H0I2.
CleanExiHS_C16orf48.
GenevestigatoriQ9H0I2.

Organism-specific databases

HPAiHPA041163.
HPA041478.

Interactioni

Protein-protein interaction databases

BioGridi123875. 16 interactions.
IntActiQ9H0I2. 22 interactions.
MINTiMINT-4725841.
STRINGi9606.ENSP00000243878.

Structurei

3D structure databases

ProteinModelPortaliQ9H0I2.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini251 – 34393EnkurinAdd
BLAST

Sequence similaritiesi

Contains 1 enkurin domain.

Phylogenomic databases

eggNOGiNOG86873.
HOGENOMiHOG000007786.
HOVERGENiHBG081309.
InParanoidiQ9H0I2.
OMAiCPDYYRR.
OrthoDBiEOG7288RH.
PhylomeDBiQ9H0I2.
TreeFamiTF328494.

Family and domain databases

InterProiIPR027710. ENKD1.
IPR027012. Enkurin_dom.
[Graphical view]
PANTHERiPTHR21490:SF2. PTHR21490:SF2. 1 hit.
PfamiPF13864. Enkurin. 1 hit.
[Graphical view]
PROSITEiPS51665. ENKURIN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9H0I2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MCEGPSRISG PIPPDPTLCP DNYRRPTSAQ GRLEGNALKL DLLTSDRALD    50
TTAPRGPCIG PGAGEILERG QRGVGDVLLQ LEGISLGPGA SLKRKDPKDH 100
EKENLRRIRE IQKRFREQER SREQGQPRPL KALWRSPKYD KVESRVKAQL 150
QEPGPASGTE SAHFLRAHSR CGPGLPPPHV SSPQPTPPGP EAKEPGLGVD 200
FIRHNARAAK RAPRRHSCSL QVLAQVLEQQ RQAQEHYNAT QKGHVPHYLL 250
ERRDLWRREA EARKQSQPDP AMPPGHTRMP ENQRLETLTK LLQSQSQLLR 300
ELVLLPAGAD SLRAQSHRAE LDRKLVQVEE AIKIFSRPKV FVKMDD 346
Length:346
Mass (Da):38,759
Last modified:March 1, 2001 - v1
Checksum:iEDB07D64A0BB23FF
GO
Isoform 2 (identifier: Q9H0I2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-118: Missing.
     119-149: ERSREQGQPRPLKALWRSPKYDKVESRVKAQ → MDAKVRRAKMARVLQLEPQTSACLLSLLCPA

Note: No experimental confirmation available.

Show »
Length:228
Mass (Da):25,546
Checksum:iF87899DB5874FF4C
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 118118Missing in isoform 2. VSP_021904Add
BLAST
Alternative sequencei119 – 14931ERSRE…RVKAQ → MDAKVRRAKMARVLQLEPQT SACLLSLLCPA in isoform 2. VSP_021905Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AL136786 mRNA. Translation: CAB66720.1.
AY358834 mRNA. Translation: AAQ89193.1.
BC008284 mRNA. Translation: AAH08284.1.
CCDSiCCDS10844.1. [Q9H0I2-1]
RefSeqiNP_115516.1. NM_032140.1. [Q9H0I2-1]
UniGeneiHs.729159.

Genome annotation databases

EnsembliENST00000243878; ENSP00000243878; ENSG00000124074. [Q9H0I2-1]
GeneIDi84080.
KEGGihsa:84080.
UCSCiuc002etv.1. human. [Q9H0I2-2]
uc002etw.1. human. [Q9H0I2-1]

Polymorphism databases

DMDMi74752565.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AL136786 mRNA. Translation: CAB66720.1 .
AY358834 mRNA. Translation: AAQ89193.1 .
BC008284 mRNA. Translation: AAH08284.1 .
CCDSi CCDS10844.1. [Q9H0I2-1 ]
RefSeqi NP_115516.1. NM_032140.1. [Q9H0I2-1 ]
UniGenei Hs.729159.

3D structure databases

ProteinModelPortali Q9H0I2.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 123875. 16 interactions.
IntActi Q9H0I2. 22 interactions.
MINTi MINT-4725841.
STRINGi 9606.ENSP00000243878.

PTM databases

PhosphoSitei Q9H0I2.

Polymorphism databases

DMDMi 74752565.

Proteomic databases

MaxQBi Q9H0I2.
PaxDbi Q9H0I2.
PRIDEi Q9H0I2.

Protocols and materials databases

DNASUi 84080.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000243878 ; ENSP00000243878 ; ENSG00000124074 . [Q9H0I2-1 ]
GeneIDi 84080.
KEGGi hsa:84080.
UCSCi uc002etv.1. human. [Q9H0I2-2 ]
uc002etw.1. human. [Q9H0I2-1 ]

Organism-specific databases

CTDi 84080.
GeneCardsi GC16M067697.
H-InvDB HIX0013154.
HGNCi HGNC:25246. ENKD1.
HPAi HPA041163.
HPA041478.
neXtProti NX_Q9H0I2.
PharmGKBi PA142672256.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG86873.
HOGENOMi HOG000007786.
HOVERGENi HBG081309.
InParanoidi Q9H0I2.
OMAi CPDYYRR.
OrthoDBi EOG7288RH.
PhylomeDBi Q9H0I2.
TreeFami TF328494.

Miscellaneous databases

ChiTaRSi C16orf48. human.
GeneWikii C16orf48.
GenomeRNAii 84080.
NextBioi 73303.

Gene expression databases

Bgeei Q9H0I2.
CleanExi HS_C16orf48.
Genevestigatori Q9H0I2.

Family and domain databases

InterProi IPR027710. ENKD1.
IPR027012. Enkurin_dom.
[Graphical view ]
PANTHERi PTHR21490:SF2. PTHR21490:SF2. 1 hit.
Pfami PF13864. Enkurin. 1 hit.
[Graphical view ]
PROSITEi PS51665. ENKURIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Placenta.

Entry informationi

Entry nameiENKD1_HUMAN
AccessioniPrimary (citable) accession number: Q9H0I2
Secondary accession number(s): Q6UWD7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 12, 2006
Last sequence update: March 1, 2001
Last modified: July 9, 2014
This is version 94 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi