Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9H0I2 (ENKD1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 94. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Enkurin domain-containing protein 1
Gene names
Name:ENKD1
Synonyms:C16orf48
ORF Names:UNQ6410/PRO21183
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length346 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Sequence similarities

Contains 1 enkurin domain.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentcytoplasmic microtubule

Inferred from direct assay PubMed 23264731. Source: UniProtKB

microtubule cytoskeleton

Inferred from direct assay. Source: LIFEdb

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9H0I2-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9H0I2-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-118: Missing.
     119-149: ERSREQGQPRPLKALWRSPKYDKVESRVKAQ → MDAKVRRAKMARVLQLEPQTSACLLSLLCPA
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 346346Enkurin domain-containing protein 1
PRO_0000265931

Regions

Domain251 – 34393Enkurin

Natural variations

Alternative sequence1 – 118118Missing in isoform 2.
VSP_021904
Alternative sequence119 – 14931ERSRE…RVKAQ → MDAKVRRAKMARVLQLEPQT SACLLSLLCPA in isoform 2.
VSP_021905

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 1, 2001. Version 1.
Checksum: EDB07D64A0BB23FF

FASTA34638,759
        10         20         30         40         50         60 
MCEGPSRISG PIPPDPTLCP DNYRRPTSAQ GRLEGNALKL DLLTSDRALD TTAPRGPCIG 

        70         80         90        100        110        120 
PGAGEILERG QRGVGDVLLQ LEGISLGPGA SLKRKDPKDH EKENLRRIRE IQKRFREQER 

       130        140        150        160        170        180 
SREQGQPRPL KALWRSPKYD KVESRVKAQL QEPGPASGTE SAHFLRAHSR CGPGLPPPHV 

       190        200        210        220        230        240 
SSPQPTPPGP EAKEPGLGVD FIRHNARAAK RAPRRHSCSL QVLAQVLEQQ RQAQEHYNAT 

       250        260        270        280        290        300 
QKGHVPHYLL ERRDLWRREA EARKQSQPDP AMPPGHTRMP ENQRLETLTK LLQSQSQLLR 

       310        320        330        340 
ELVLLPAGAD SLRAQSHRAE LDRKLVQVEE AIKIFSRPKV FVKMDD 

« Hide

Isoform 2 [UniParc].

Checksum: F87899DB5874FF4C
Show »

FASTA22825,546

References

[1]"Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs."
Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. expand/collapse author list , Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.
Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[2]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Placenta.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AL136786 mRNA. Translation: CAB66720.1.
AY358834 mRNA. Translation: AAQ89193.1.
BC008284 mRNA. Translation: AAH08284.1.
CCDSCCDS10844.1. [Q9H0I2-1]
RefSeqNP_115516.1. NM_032140.1. [Q9H0I2-1]
UniGeneHs.729159.

3D structure databases

ProteinModelPortalQ9H0I2.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid123875. 16 interactions.
IntActQ9H0I2. 22 interactions.
MINTMINT-4725841.
STRING9606.ENSP00000243878.

PTM databases

PhosphoSiteQ9H0I2.

Polymorphism databases

DMDM74752565.

Proteomic databases

MaxQBQ9H0I2.
PaxDbQ9H0I2.
PRIDEQ9H0I2.

Protocols and materials databases

DNASU84080.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000243878; ENSP00000243878; ENSG00000124074. [Q9H0I2-1]
GeneID84080.
KEGGhsa:84080.
UCSCuc002etv.1. human. [Q9H0I2-2]
uc002etw.1. human. [Q9H0I2-1]

Organism-specific databases

CTD84080.
GeneCardsGC16M067697.
H-InvDBHIX0013154.
HGNCHGNC:25246. ENKD1.
HPAHPA041163.
HPA041478.
neXtProtNX_Q9H0I2.
PharmGKBPA142672256.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG86873.
HOGENOMHOG000007786.
HOVERGENHBG081309.
InParanoidQ9H0I2.
OMACPDYYRR.
OrthoDBEOG7288RH.
PhylomeDBQ9H0I2.
TreeFamTF328494.

Gene expression databases

BgeeQ9H0I2.
CleanExHS_C16orf48.
GenevestigatorQ9H0I2.

Family and domain databases

InterProIPR027710. ENKD1.
IPR027012. Enkurin_dom.
[Graphical view]
PANTHERPTHR21490:SF2. PTHR21490:SF2. 1 hit.
PfamPF13864. Enkurin. 1 hit.
[Graphical view]
PROSITEPS51665. ENKURIN. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSC16orf48. human.
GeneWikiC16orf48.
GenomeRNAi84080.
NextBio73303.

Entry information

Entry nameENKD1_HUMAN
AccessionPrimary (citable) accession number: Q9H0I2
Secondary accession number(s): Q6UWD7
Entry history
Integrated into UniProtKB/Swiss-Prot: December 12, 2006
Last sequence update: March 1, 2001
Last modified: July 9, 2014
This is version 94 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome 16

Human chromosome 16: entries, gene names and cross-references to MIM