Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Enkurin domain-containing protein 1

Gene

ENKD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Enkurin domain-containing protein 1
Gene namesi
Name:ENKD1
Synonyms:C16orf48
ORF Names:UNQ6410/PRO21183
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:25246. ENKD1.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasmic microtubule Source: UniProtKB
  2. microtubule cytoskeleton Source: LIFEdb
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142672256.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 346346Enkurin domain-containing protein 1PRO_0000265931Add
BLAST

Proteomic databases

MaxQBiQ9H0I2.
PaxDbiQ9H0I2.
PRIDEiQ9H0I2.

PTM databases

PhosphoSiteiQ9H0I2.

Expressioni

Gene expression databases

BgeeiQ9H0I2.
CleanExiHS_C16orf48.
ExpressionAtlasiQ9H0I2. baseline and differential.
GenevestigatoriQ9H0I2.

Organism-specific databases

HPAiHPA041163.
HPA041478.

Interactioni

Protein-protein interaction databases

BioGridi123875. 35 interactions.
IntActiQ9H0I2. 22 interactions.
MINTiMINT-4725841.
STRINGi9606.ENSP00000243878.

Structurei

3D structure databases

ProteinModelPortaliQ9H0I2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini251 – 34393EnkurinPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 enkurin domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG86873.
GeneTreeiENSGT00390000018139.
HOGENOMiHOG000007786.
HOVERGENiHBG081309.
InParanoidiQ9H0I2.
OMAiCPDYYRR.
OrthoDBiEOG7288RH.
PhylomeDBiQ9H0I2.
TreeFamiTF328494.

Family and domain databases

InterProiIPR027710. ENKD1.
IPR027012. Enkurin_dom.
[Graphical view]
PANTHERiPTHR21490:SF2. PTHR21490:SF2. 1 hit.
PfamiPF13864. Enkurin. 1 hit.
[Graphical view]
PROSITEiPS51665. ENKURIN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H0I2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MCEGPSRISG PIPPDPTLCP DNYRRPTSAQ GRLEGNALKL DLLTSDRALD
60 70 80 90 100
TTAPRGPCIG PGAGEILERG QRGVGDVLLQ LEGISLGPGA SLKRKDPKDH
110 120 130 140 150
EKENLRRIRE IQKRFREQER SREQGQPRPL KALWRSPKYD KVESRVKAQL
160 170 180 190 200
QEPGPASGTE SAHFLRAHSR CGPGLPPPHV SSPQPTPPGP EAKEPGLGVD
210 220 230 240 250
FIRHNARAAK RAPRRHSCSL QVLAQVLEQQ RQAQEHYNAT QKGHVPHYLL
260 270 280 290 300
ERRDLWRREA EARKQSQPDP AMPPGHTRMP ENQRLETLTK LLQSQSQLLR
310 320 330 340
ELVLLPAGAD SLRAQSHRAE LDRKLVQVEE AIKIFSRPKV FVKMDD
Length:346
Mass (Da):38,759
Last modified:February 28, 2001 - v1
Checksum:iEDB07D64A0BB23FF
GO
Isoform 2 (identifier: Q9H0I2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-118: Missing.
     119-149: ERSREQGQPRPLKALWRSPKYDKVESRVKAQ → MDAKVRRAKMARVLQLEPQTSACLLSLLCPA

Note: No experimental confirmation available.

Show »
Length:228
Mass (Da):25,546
Checksum:iF87899DB5874FF4C
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 118118Missing in isoform 2. 1 PublicationVSP_021904Add
BLAST
Alternative sequencei119 – 14931ERSRE…RVKAQ → MDAKVRRAKMARVLQLEPQT SACLLSLLCPA in isoform 2. 1 PublicationVSP_021905Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136786 mRNA. Translation: CAB66720.1.
AY358834 mRNA. Translation: AAQ89193.1.
BC008284 mRNA. Translation: AAH08284.1.
CCDSiCCDS10844.1. [Q9H0I2-1]
RefSeqiNP_115516.1. NM_032140.1. [Q9H0I2-1]
UniGeneiHs.729159.

Genome annotation databases

EnsembliENST00000243878; ENSP00000243878; ENSG00000124074. [Q9H0I2-1]
GeneIDi84080.
KEGGihsa:84080.
UCSCiuc002etv.1. human. [Q9H0I2-2]
uc002etw.1. human. [Q9H0I2-1]

Polymorphism databases

DMDMi74752565.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136786 mRNA. Translation: CAB66720.1.
AY358834 mRNA. Translation: AAQ89193.1.
BC008284 mRNA. Translation: AAH08284.1.
CCDSiCCDS10844.1. [Q9H0I2-1]
RefSeqiNP_115516.1. NM_032140.1. [Q9H0I2-1]
UniGeneiHs.729159.

3D structure databases

ProteinModelPortaliQ9H0I2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123875. 35 interactions.
IntActiQ9H0I2. 22 interactions.
MINTiMINT-4725841.
STRINGi9606.ENSP00000243878.

PTM databases

PhosphoSiteiQ9H0I2.

Polymorphism databases

DMDMi74752565.

Proteomic databases

MaxQBiQ9H0I2.
PaxDbiQ9H0I2.
PRIDEiQ9H0I2.

Protocols and materials databases

DNASUi84080.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000243878; ENSP00000243878; ENSG00000124074. [Q9H0I2-1]
GeneIDi84080.
KEGGihsa:84080.
UCSCiuc002etv.1. human. [Q9H0I2-2]
uc002etw.1. human. [Q9H0I2-1]

Organism-specific databases

CTDi84080.
GeneCardsiGC16M067697.
H-InvDBHIX0013154.
HGNCiHGNC:25246. ENKD1.
HPAiHPA041163.
HPA041478.
neXtProtiNX_Q9H0I2.
PharmGKBiPA142672256.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG86873.
GeneTreeiENSGT00390000018139.
HOGENOMiHOG000007786.
HOVERGENiHBG081309.
InParanoidiQ9H0I2.
OMAiCPDYYRR.
OrthoDBiEOG7288RH.
PhylomeDBiQ9H0I2.
TreeFamiTF328494.

Miscellaneous databases

GeneWikiiC16orf48.
GenomeRNAii84080.
NextBioi73303.

Gene expression databases

BgeeiQ9H0I2.
CleanExiHS_C16orf48.
ExpressionAtlasiQ9H0I2. baseline and differential.
GenevestigatoriQ9H0I2.

Family and domain databases

InterProiIPR027710. ENKD1.
IPR027012. Enkurin_dom.
[Graphical view]
PANTHERiPTHR21490:SF2. PTHR21490:SF2. 1 hit.
PfamiPF13864. Enkurin. 1 hit.
[Graphical view]
PROSITEiPS51665. ENKURIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Placenta.

Entry informationi

Entry nameiENKD1_HUMAN
AccessioniPrimary (citable) accession number: Q9H0I2
Secondary accession number(s): Q6UWD7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 11, 2006
Last sequence update: February 28, 2001
Last modified: February 3, 2015
This is version 99 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.