Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9H0I2

- ENKD1_HUMAN

UniProt

Q9H0I2 - ENKD1_HUMAN

Protein

Enkurin domain-containing protein 1

Gene

ENKD1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 95 (01 Oct 2014)
      Sequence version 1 (01 Mar 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Enkurin domain-containing protein 1
    Gene namesi
    Name:ENKD1
    Synonyms:C16orf48
    ORF Names:UNQ6410/PRO21183
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 16

    Organism-specific databases

    HGNCiHGNC:25246. ENKD1.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasmic microtubule Source: UniProtKB
    2. microtubule cytoskeleton Source: LIFEdb

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142672256.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 346346Enkurin domain-containing protein 1PRO_0000265931Add
    BLAST

    Proteomic databases

    MaxQBiQ9H0I2.
    PaxDbiQ9H0I2.
    PRIDEiQ9H0I2.

    PTM databases

    PhosphoSiteiQ9H0I2.

    Expressioni

    Gene expression databases

    BgeeiQ9H0I2.
    CleanExiHS_C16orf48.
    GenevestigatoriQ9H0I2.

    Organism-specific databases

    HPAiHPA041163.
    HPA041478.

    Interactioni

    Protein-protein interaction databases

    BioGridi123875. 16 interactions.
    IntActiQ9H0I2. 22 interactions.
    MINTiMINT-4725841.
    STRINGi9606.ENSP00000243878.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9H0I2.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini251 – 34393EnkurinPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 enkurin domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG86873.
    HOGENOMiHOG000007786.
    HOVERGENiHBG081309.
    InParanoidiQ9H0I2.
    OMAiCPDYYRR.
    OrthoDBiEOG7288RH.
    PhylomeDBiQ9H0I2.
    TreeFamiTF328494.

    Family and domain databases

    InterProiIPR027710. ENKD1.
    IPR027012. Enkurin_dom.
    [Graphical view]
    PANTHERiPTHR21490:SF2. PTHR21490:SF2. 1 hit.
    PfamiPF13864. Enkurin. 1 hit.
    [Graphical view]
    PROSITEiPS51665. ENKURIN. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9H0I2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MCEGPSRISG PIPPDPTLCP DNYRRPTSAQ GRLEGNALKL DLLTSDRALD    50
    TTAPRGPCIG PGAGEILERG QRGVGDVLLQ LEGISLGPGA SLKRKDPKDH 100
    EKENLRRIRE IQKRFREQER SREQGQPRPL KALWRSPKYD KVESRVKAQL 150
    QEPGPASGTE SAHFLRAHSR CGPGLPPPHV SSPQPTPPGP EAKEPGLGVD 200
    FIRHNARAAK RAPRRHSCSL QVLAQVLEQQ RQAQEHYNAT QKGHVPHYLL 250
    ERRDLWRREA EARKQSQPDP AMPPGHTRMP ENQRLETLTK LLQSQSQLLR 300
    ELVLLPAGAD SLRAQSHRAE LDRKLVQVEE AIKIFSRPKV FVKMDD 346
    Length:346
    Mass (Da):38,759
    Last modified:March 1, 2001 - v1
    Checksum:iEDB07D64A0BB23FF
    GO
    Isoform 2 (identifier: Q9H0I2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-118: Missing.
         119-149: ERSREQGQPRPLKALWRSPKYDKVESRVKAQ → MDAKVRRAKMARVLQLEPQTSACLLSLLCPA

    Note: No experimental confirmation available.

    Show »
    Length:228
    Mass (Da):25,546
    Checksum:iF87899DB5874FF4C
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 118118Missing in isoform 2. 1 PublicationVSP_021904Add
    BLAST
    Alternative sequencei119 – 14931ERSRE…RVKAQ → MDAKVRRAKMARVLQLEPQT SACLLSLLCPA in isoform 2. 1 PublicationVSP_021905Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AL136786 mRNA. Translation: CAB66720.1.
    AY358834 mRNA. Translation: AAQ89193.1.
    BC008284 mRNA. Translation: AAH08284.1.
    CCDSiCCDS10844.1. [Q9H0I2-1]
    RefSeqiNP_115516.1. NM_032140.1. [Q9H0I2-1]
    UniGeneiHs.729159.

    Genome annotation databases

    EnsembliENST00000243878; ENSP00000243878; ENSG00000124074. [Q9H0I2-1]
    GeneIDi84080.
    KEGGihsa:84080.
    UCSCiuc002etv.1. human. [Q9H0I2-2]
    uc002etw.1. human. [Q9H0I2-1]

    Polymorphism databases

    DMDMi74752565.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AL136786 mRNA. Translation: CAB66720.1 .
    AY358834 mRNA. Translation: AAQ89193.1 .
    BC008284 mRNA. Translation: AAH08284.1 .
    CCDSi CCDS10844.1. [Q9H0I2-1 ]
    RefSeqi NP_115516.1. NM_032140.1. [Q9H0I2-1 ]
    UniGenei Hs.729159.

    3D structure databases

    ProteinModelPortali Q9H0I2.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 123875. 16 interactions.
    IntActi Q9H0I2. 22 interactions.
    MINTi MINT-4725841.
    STRINGi 9606.ENSP00000243878.

    PTM databases

    PhosphoSitei Q9H0I2.

    Polymorphism databases

    DMDMi 74752565.

    Proteomic databases

    MaxQBi Q9H0I2.
    PaxDbi Q9H0I2.
    PRIDEi Q9H0I2.

    Protocols and materials databases

    DNASUi 84080.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000243878 ; ENSP00000243878 ; ENSG00000124074 . [Q9H0I2-1 ]
    GeneIDi 84080.
    KEGGi hsa:84080.
    UCSCi uc002etv.1. human. [Q9H0I2-2 ]
    uc002etw.1. human. [Q9H0I2-1 ]

    Organism-specific databases

    CTDi 84080.
    GeneCardsi GC16M067697.
    H-InvDB HIX0013154.
    HGNCi HGNC:25246. ENKD1.
    HPAi HPA041163.
    HPA041478.
    neXtProti NX_Q9H0I2.
    PharmGKBi PA142672256.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG86873.
    HOGENOMi HOG000007786.
    HOVERGENi HBG081309.
    InParanoidi Q9H0I2.
    OMAi CPDYYRR.
    OrthoDBi EOG7288RH.
    PhylomeDBi Q9H0I2.
    TreeFami TF328494.

    Miscellaneous databases

    ChiTaRSi C16orf48. human.
    GeneWikii C16orf48.
    GenomeRNAii 84080.
    NextBioi 73303.

    Gene expression databases

    Bgeei Q9H0I2.
    CleanExi HS_C16orf48.
    Genevestigatori Q9H0I2.

    Family and domain databases

    InterProi IPR027710. ENKD1.
    IPR027012. Enkurin_dom.
    [Graphical view ]
    PANTHERi PTHR21490:SF2. PTHR21490:SF2. 1 hit.
    Pfami PF13864. Enkurin. 1 hit.
    [Graphical view ]
    PROSITEi PS51665. ENKURIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Placenta.

    Entry informationi

    Entry nameiENKD1_HUMAN
    AccessioniPrimary (citable) accession number: Q9H0I2
    Secondary accession number(s): Q6UWD7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 12, 2006
    Last sequence update: March 1, 2001
    Last modified: October 1, 2014
    This is version 95 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3