Q9H0E9 (BRD8_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 106.
History...
Clusters with 
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Bromodomain-containing protein 8 Alternative name(s): Skeletal muscle abundant protein Skeletal muscle abundant protein 2 Thyroid hormone receptor coactivating protein of 120 kDa Short name=TrCP120 p120 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1235 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May act as a coactivator during transcriptional activation by hormone-activated nuclear receptors (NR). Isoform 2 stimulates transcriptional activation by AR/DHTR, ESR1/NR3A1, RXRA/NR2B1 and THRB/ERBA2. At least isoform 1 and isoform 2 are components of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. Ref.9 Ref.11 |
| Subunit structure | Component of the NuA4 histone acetyltransferase complex which contains the catalytic subunit KAT5/TIP60 and the subunits EP400, TRRAP/PAF400, BRD8/SMAP, EPC1, DMAP1/DNMAP1, RUVBL1/TIP49, RUVBL2, ING3, actin, ACTL6A/BAF53A, MORF4L1/MRG15, MORF4L2/MRGX, MRGBP, YEATS4/GAS41, VPS72/YL1 and MEAF6. The NuA4 complex interacts with MYC and the adenovirus E1A protein. Component of a NuA4-related complex which contains EP400, TRRAP/PAF400, SRCAP, BRD8/SMAP, EPC1, DMAP1/DNMAP1, RUVBL1/TIP49, RUVBL2, actin, ACTL6A/BAF53A, VPS72 and YEATS4/GAS41. BRD8 isoform 2 interacts with RXRA/NR2B1 and THRB/ERBA2 By similarity. Ref.6 Ref.8 Ref.9 Ref.11 |
| Subcellular location | |
| Tissue specificity | Expressed in adipose tissue, brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle. Ref.1 |
| Sequence similarities | Contains 2 bromo domains. |
| Caution | It is uncertain whether Met-1 or Met-32 is the initiator. |
| Sequence caution | The sequence AAB87858.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAH08039.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAH08076.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence CAA63925.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Growth regulation Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Bromodomain Coiled coil Repeat |
| Molecular function | Chromatin regulator |
| PTM | Acetylation Phosphoprotein |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell surface receptor signaling pathway Traceable author statement Ref.6. Source: ProtInc histone H2A acetylationInferred from direct assay Ref.11. Source: UniProtKB histone H4 acetylationInferred from direct assay Ref.11. Source: UniProtKB regulation of growthInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | NuA4 histone acetyltransferase complex Inferred from direct assay Ref.11. Source: UniProtKB mitochondrionInferred from direct assay. Source: HPA |
| Molecular_function | thyroid hormone receptor activity Traceable author statement Ref.6. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9H0E9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9H0E9-2) The sequence of this isoform differs from the canonical sequence as follows: 215-215: V → VTPGTLPSTPVTSFPGIPDTLPPGSAPLEAPMTPVTDDSPQKKMLGQKATPPPSPLLSELLKKGSLLPTSPRLV 860-878: MGHEWVWLDSEQDHPNDSE → DGGTRGRRCAIEADMKMKK 879-1235: Missing. | ||||||
| Note: Contains a phosphothreonine at position 264. Contains a phosphoserine at position 268. Contains a phosphoserine at position 284. Contains a phosphoserine at position 924. | ||||||
| Isoform 3 (identifier: Q9H0E9-3) The sequence of this isoform differs from the canonical sequence as follows: 1-147: MATGTGKHKL...LDELCNDIAT → MSFAMTL 215-215: V → VTPGTLPSTPVTSFPGIPDTLPPGSAPLEAPMTPVTDDSPQKKMLGQKATPPPSPLLSELLKKGSLLPTSPRLV 263-301: Missing. 845-859: Missing. 860-878: MGHEWVWLDSEQDHPNDSE → DGGTRGRRCAIEADMKMKK 879-1235: Missing. | ||||||
| Note: Contains a phosphothreonine at position 124. Contains a phosphoserine at position 128. Contains a phosphoserine at position 144. | ||||||
| Isoform 4 (identifier: Q9H0E9-4) The sequence of this isoform differs from the canonical sequence as follows: 215-215: V → VTPGTLPSTPVTSFPGIPDTLPPGSAPLEAPMTPVTDDSPQKKMLGQKATPPPSPLLSELLKKGSLLPTSPRLV 263-332: Missing. 846-846: S → G 847-975: Missing. 979-992: QEGREIKASEGERE → GRRCAIEADMKMKK 993-1235: Missing. | ||||||
| Note: Contains a phosphothreonine at position 264. Contains a phosphoserine at position 268. Contains a phosphoserine at position 284. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1235 | 1235 | Bromodomain-containing protein 8 | PRO_0000211185 | |||||
Regions | |||||||||
| Domain | 724 – 794 | 71 | Bromo 1 | ||||||
| Domain | 1120 – 1190 | 71 | Bromo 2 | ||||||
| Coiled coil | 97 – 171 | 75 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 387 | 1 | Phosphoserine Ref.13 | ||||||
| Modified residue | 481 | 1 | N6-acetyllysine Ref.16 | ||||||
| Modified residue | 621 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 637 | 1 | Phosphoserine Ref.12 | ||||||
| Modified residue | 641 | 1 | Phosphoserine Ref.12 Ref.17 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 147 | 147 | MATGT…NDIAT → MSFAMTL in isoform 3. | VSP_012879 | |||||
| Alternative sequence | 215 | 1 | V → VTPGTLPSTPVTSFPGIPDT LPPGSAPLEAPMTPVTDDSP QKKMLGQKATPPPSPLLSEL LKKGSLLPTSPRLV in isoform 2, isoform 3 and isoform 4. | VSP_012880 | |||||
| Alternative sequence | 263 – 332 | 70 | Missing in isoform 4. | VSP_023187 | |||||
| Alternative sequence | 263 – 301 | 39 | Missing in isoform 3. | VSP_012881 | |||||
| Alternative sequence | 845 – 859 | 15 | Missing in isoform 3. | VSP_012882 | |||||
| Alternative sequence | 846 | 1 | S → G in isoform 4. | VSP_023188 | |||||
| Alternative sequence | 847 – 975 | 129 | Missing in isoform 4. | VSP_023189 | |||||
| Alternative sequence | 860 – 878 | 19 | MGHEW…PNDSE → DGGTRGRRCAIEADMKMKK in isoform 2 and isoform 3. | VSP_012883 | |||||
| Alternative sequence | 879 – 1235 | 357 | Missing in isoform 2 and isoform 3. | VSP_012884 | |||||
| Alternative sequence | 979 – 992 | 14 | QEGRE…EGERE → GRRCAIEADMKMKK in isoform 4. | VSP_023190 | |||||
| Alternative sequence | 993 – 1235 | 243 | Missing in isoform 4. | VSP_023191 | |||||
| Natural variant | 490 | 1 | T → M. Ref.3 Corresponds to variant rs11750814 [ dbSNP | Ensembl ]. | VAR_030695 | |||||
| Natural variant | 896 | 1 | L → P. Corresponds to variant rs6883021 [ dbSNP | Ensembl ]. | VAR_048428 | |||||
| Natural variant | 1198 | 1 | Q → R. Ref.1 Ref.2 Ref.3 Ref.5 Ref.6 Ref.7 Corresponds to variant rs412051 [ dbSNP | Ensembl ]. | VAR_048429 | |||||
Experimental info | |||||||||
| Sequence conflict | 306 | 1 | Q → H in AAB87858. Ref.6 | ||||||
| Sequence conflict | 557 | 1 | V → L in CAA60949. Ref.1 | ||||||
| Sequence conflict | 557 | 1 | V → L in CAA63925. Ref.7 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and sequencing of a human cDNA encoding a putative transcription factor containing a bromodomain." Nielsen M.S., Petersen C.M., Gliemann J., Madsen P. Biochim. Biophys. Acta 1306:14-16(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY, VARIANT ARG-1198. |
| [2] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B.  Poustka A.Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ARG-1198. Tissue: Testis. |
| [3] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS MET-490 AND ARG-1198. Tissue: Brain. |
| [4] | "The DNA sequence and comparative analysis of human chromosome 5." Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. Rubin E.M.Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 2-1235 (ISOFORM 2), VARIANT ARG-1198. Tissue: Muscle. |
| [6] | "Isolation and characterization of a novel ligand-dependent thyroid hormone receptor-coactivating protein." Monden T., Wondisford F.E., Hollenberg A.N. J. Biol. Chem. 272:29834-29841(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 6-1235 (ISOFORM 2), INTERACTION WITH THRB, VARIANT ARG-1198. Tissue: Brain. |
| [7] | Nielsen M.S. Submitted (DEC-1995) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 6-1235 (ISOFORM 4), VARIANT ARG-1198. Tissue: Skin. |
| [8] | "Identification of new subunits of the multiprotein mammalian TRRAP/TIP60-containing histone acetyltransferase complex." Cai Y., Jin J., Tomomori-Sato C., Sato S., Sorokina I., Parmely T.J., Conaway R.C., Conaway J.W. J. Biol. Chem. 278:42733-42736(2003) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 34-44; 63-79; 83-98; 125-137; 138-148; 150-159; 270-295; 385-399; 485-493; 541-565; 576-604 AND 625-646, IDENTIFICATION IN NUA4 COMPLEX (ISOFORM 2), MASS SPECTROMETRY. |
| [9] | "p120 acts as a specific coactivator for 9-cis-retinoic acid receptor (RXR) on peroxisome proliferator-activated receptor-gamma/RXR heterodimers." Monden T., Kishi M., Hosoya T., Satoh T., Wondisford F.E., Hollenberg A.N., Yamada M., Mori M. Mol. Endocrinol. 13:1695-1703(1999) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH RXRA. |
| [10] | "The highly conserved and multifunctional NuA4 HAT complex." Doyon Y., Cote J. Curr. Opin. Genet. Dev. 14:147-154(2004) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON NUA4 COMPLEX. |
| [11] | "Structural and functional conservation of the NuA4 histone acetyltransferase complex from yeast to humans." Doyon Y., Selleck W., Lane W.S., Tan S., Cote J. Mol. Cell. Biol. 24:1884-1896(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN NUA4 COMPLEX (ISOFORMS 1 AND 2), IDENTIFICATION IN NUA4-RELATED SRCAP-CONTAINING COMPLEX. |
| [12] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-637 AND SER-641, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment." Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J. J. Proteome Res. 7:5167-5176(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-387, MASS SPECTROMETRY. Tissue: T-cell. |
| [14] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-264; SER-268 AND SER-284 (ISOFORMS 2 AND 4), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-124; SER-128 AND SER-144 (ISOFORM 3), MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [15] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-264 AND SER-268 (ISOFORMS 2 AND 4), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-124 AND SER-128 (ISOFORM 3), MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [16] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-481, MASS SPECTROMETRY. |
| [17] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-621 AND SER-641, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-924 (ISOFORM 2), MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X87613 mRNA. Translation: CAA60949.1. AL136823 mRNA. Translation: CAB66757.1. AB209079 mRNA. Translation: BAD92316.1. AC109442 Genomic DNA. No translation available. AC113382 Genomic DNA. No translation available. BC008039 mRNA. Translation: AAH08039.1. Different initiation. BC008076 mRNA. Translation: AAH08076.1. Different initiation. AF016270 mRNA. Translation: AAB87858.1. Different initiation. X94234 mRNA. Translation: CAA63925.1. Different initiation. |
| IPI | IPI00016570. IPI00019226. IPI00148057. IPI00828194. |
| PIR | S58225. S68142. |
| RefSeq | NP_001157798.1. NM_001164326.1. NP_006687.3. NM_006696.3. NP_631938.1. NM_139199.1. |
| UniGene | Hs.519337. |
3D structure databases | |
| ProteinModelPortal | Q9H0E9. |
| SMR | Q9H0E9. Positions 728-806, 1090-1204. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9H0E9. 11 interactions. |
| STRING | 9606.ENSP00000254900. |
Proteomic databases | |
| PaxDb | Q9H0E9. |
| PRIDE | Q9H0E9. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000230901; ENSP00000230901; ENSG00000112983. ENST00000254900; ENSP00000254900; ENSG00000112983. ENST00000411594; ENSP00000394330; ENSG00000112983. |
| GeneID | 10902. |
| KEGG | hsa:10902. |
| UCSC | uc003lcf.1. human. uc003lcg.3. human. uc003lci.3. human. uc021yea.1. human. |
Organism-specific databases | |
| CTD | 10902. |
| GeneCards | GC05M137475. |
| HGNC | HGNC:19874. BRD8. |
| HPA | HPA001841. |
| MIM | 602848. gene. |
| neXtProt | NX_Q9H0E9. |
| PharmGKB | PA134923194. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5076. |
| HOGENOM | HOG000074125. |
| HOVERGEN | HBG050732. |
| InParanoid | Q9H0E9. |
| KO | K11321. |
| OrthoDB | EOG470THC. |
| PhylomeDB | Q9H0E9. |
Gene expression databases | |
| ArrayExpress | Q9H0E9. |
| Bgee | Q9H0E9. |
| CleanEx | HS_BRD8. HS_SMAP2. |
| Genevestigator | Q9H0E9. |
| GermOnline | ENSG00000112983. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.20.920.10. 2 hits. |
| InterPro | IPR001487. Bromodomain. [Graphical view] |
| Pfam | PF00439. Bromodomain. 2 hits. [Graphical view] |
| PRINTS | PR00503. BROMODOMAIN. |
| SMART | SM00297. BROMO. 2 hits. [Graphical view] |
| SUPFAM | SSF47370. Bromodomain. 2 hits. |
| PROSITE | PS00633. BROMODOMAIN_1. False negative. PS50014. BROMODOMAIN_2. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | BRD8. human. |
| GenomeRNAi | 10902. |
| NextBio | 41403. |
| PMAP-CutDB | Q9H0E9. |
| SOURCE | Search... |
Entry information
| Entry name | BRD8_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H0E9 Secondary accession number(s): O43178 Q969M9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |