Q9H0E3 (SP130_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 68.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Histone deacetylase complex subunit SAP130 Alternative name(s): 130 kDa Sin3-associated polypeptide Sin3-associated polypeptide p130 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1048 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes. Ref.1 |
| Subunit structure | Component of a mSin3A corepressor complex that contains SIN3A, SAP130, SUDS3/SAP45, ARID4B/SAP180, HDAC1 and HDAC2. Interacts (released by dead or dying cells) with CLEC4E By similarity. |
| Subcellular location | Nucleus By similarity. |
| Tissue specificity | Expressed in various cancer cell ines. Ref.1 |
| Domain | The N-terminus may interact with a transcriptional coactivator. The C-terminus may interact with HDAC-dependent and HDAC-independent corepressors. |
| Post-translational modification | Acetylated Probable. |
| Sequence similarities | Belongs to the SAP130 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Repressor |
| PTM | Acetylation Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | histone H3 acetylation Inferred from direct assay. Source: UniProtKB regulation of transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | STAGA complex Inferred from direct assay. Source: UniProtKB |
| Molecular function | transcription coactivator activity Inferred from direct assay. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9H0E3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9H0E3-2) The sequence of this isoform differs from the canonical sequence as follows: 1-470: Missing. 678-678: D → DGMAVRKTLIPPQPPDVASPRVESSMRSTSGSPRPA |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1048 | 1048 | Histone deacetylase complex subunit SAP130 | PRO_0000283736 | |||||
Regions | |||||||||
| Region | 836 – 1047 | 212 | Interactions with SIN3A and HDAC1 | ||||||
| Compositional bias | 81 – 85 | 5 | Poly-Ser | ||||||
| Compositional bias | 124 – 169 | 46 | Pro-rich | ||||||
| Compositional bias | 234 – 238 | 5 | Poly-Ala | ||||||
| Compositional bias | 709 – 836 | 128 | Pro-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 355 | 1 | Phosphothreonine Ref.7 | ||||||
| Modified residue | 442 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 454 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 455 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 875 | 1 | Phosphoserine Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 470 | 470 | Missing in isoform 2. | VSP_024355 | |||||
| Alternative sequence | 678 | 1 | D → DGMAVRKTLIPPQPPDVASP RVESSMRSTSGSPRPA in isoform 2. | VSP_024356 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and characterization of three new components of the mSin3A corepressor complex." Fleischer T.C., Yun U.J., Ayer D.E. Mol. Cell. Biol. 23:3456-3467(2003) [PubMed: 12724404] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, ACETYLATION, IDENTIFICATION IN A MSIN3A COREPRESSOR COMPLEX WITH SIN3A; SAP130; SUDS3; ARID4B; HDAC1 AND HDAC2. |
| [2] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed: 11230166] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Testis. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [4] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [6] | "Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column." Imami K., Sugiyama N., Kyono Y., Tomita M., Ishihama Y. Anal. Sci. 24:161-166(2008) [PubMed: 18187866] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-454 AND SER-455, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [7] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-355; SER-442 AND SER-875, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY220791 mRNA. Translation: AAO63591.1. AL136833 mRNA. Translation: CAB66767.1. AK022823 mRNA. Translation: BAB14261.1. AC118060 Genomic DNA. Translation: AAX88975.1. AC012306 Genomic DNA. Translation: AAY14878.1. BC017453 mRNA. Translation: AAH17453.2. BC117255 mRNA. Translation: AAI17256.1. |
| IPI | IPI00002220. IPI00748953. |
| RefSeq | NP_001139400.1. NM_001145928.1. NP_078821.2. NM_024545.3. |
| UniGene | Hs.32995. |
3D structure databases | |
| ProteinModelPortal | Q9H0E3. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9H0E3. 2 interactions. |
| MINT | MINT-1185872. |
| STRING | Q9H0E3. |
PTM databases | |
| PhosphoSite | Q9H0E3. |
Polymorphism databases | |
| DMDM | 74717977. |
Proteomic databases | |
| PRIDE | Q9H0E3. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000259235; ENSP00000259235; ENSG00000136715. |
| GeneID | 79595. |
| KEGG | hsa:79595. |
| UCSC | uc002tpn.1. human. uc002tpp.1. human. |
Organism-specific databases | |
| CTD | 79595. |
| GeneCards | GC02M128792. |
| H-InvDB | HIX0020746. |
| HGNC | HGNC:29813. SAP130. |
| HPA | HPA034664. |
| MIM | 609697. gene. |
| neXtProt | NX_Q9H0E3. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00440000037733. |
| HOVERGEN | HBG106600. |
| OrthoDB | EOG49W2GD. |
| PhylomeDB | Q9H0E3. |
Gene expression databases | |
| ArrayExpress | Q9H0E3. |
| Bgee | Q9H0E3. |
| CleanEx | HS_SAP130. |
| Genevestigator | Q9H0E3. |
Family and domain databases | |
| InterPro | IPR024137. His_deAcase_cplx_SAP130. [Graphical view] |
| PANTHER | PTHR13497. PTHR13497. 1 hit. |
| ProtoNet | Search... |
Other | |
| NextBio | 68614. |
| SOURCE | Search... |
Entry information
| Entry name | SP130_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H0E3 Secondary accession number(s): C9K0X9 Q9H9G8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with