Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9H0E3 (SP130_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 91. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Histone deacetylase complex subunit SAP130
Alternative name(s):
130 kDa Sin3-associated polypeptide
Sin3-associated polypeptide p130
Gene names
Name:SAP130
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1048 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes. Ref.1

Subunit structure

Component of a mSin3A corepressor complex that contains SIN3A, SAP130, SUDS3/SAP45, ARID4B/SAP180, HDAC1 and HDAC2. Interacts (released by dead or dying cells) with CLEC4E By similarity. Ref.1

Subcellular location

Nucleus Ref.6.

Tissue specificity

Expressed in various cancer cell ines. Ref.1

Domain

The N-terminus may interact with a transcriptional coactivator.

The C-terminus may interact with HDAC-dependent and HDAC-independent corepressors.

Post-translational modification

Acetylated Probable. Ref.1

Sumoylated with SUMO1. Ref.6

Sequence similarities

Belongs to the SAP130 family.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9H0E3-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9H0E3-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-470: Missing.
     678-678: D → DGMAVRKTLIPPQPPDVASPRVESSMRSTSGSPRPA
Isoform 3 (identifier: Q9H0E3-3)

The sequence of this isoform differs from the canonical sequence as follows:
     678-678: D → DGMAVRKTLIPPQPPDVASPRVESSMRSTSGSPRPA
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 10481048Histone deacetylase complex subunit SAP130
PRO_0000283736

Regions

Region836 – 1047212Interactions with SIN3A and HDAC1
Compositional bias81 – 855Poly-Ser
Compositional bias124 – 16946Pro-rich
Compositional bias234 – 2385Poly-Ala
Compositional bias709 – 836128Pro-rich

Amino acid modifications

Modified residue3551Phosphothreonine Ref.7 Ref.8
Modified residue4421Phosphoserine Ref.7 Ref.8
Modified residue8551Phosphoserine Ref.8
Modified residue8561Phosphothreonine Ref.8 Ref.9
Modified residue8751Phosphoserine Ref.7

Natural variations

Alternative sequence1 – 470470Missing in isoform 2.
VSP_024355
Alternative sequence6781D → DGMAVRKTLIPPQPPDVASP RVESSMRSTSGSPRPA in isoform 2 and isoform 3.
VSP_024356

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 1, 2001. Version 1.
Checksum: EB4E74E35BA07AEE

FASTA1,048110,324
        10         20         30         40         50         60 
MGPPRHPQAG EIEAGGAGGG RRLQVEMSSQ QFPRLGAPST GLSQAPSQIA NSGSAGLINP 

        70         80         90        100        110        120 
AATVNDESGR DSEVSAREHM SSSSSLQSRE EKQEPVVVRP YPQVQMLSTH HAVASATPVA 

       130        140        150        160        170        180 
VTAPPAHLTP AVPLSFSEGL MKPPPKPTMP SRPIAPAPPS TLSLPPKVPG QVTVTMESSI 

       190        200        210        220        230        240 
PQASAIPVAT ISGQQGHPSN LHHIMTTNVQ MSIIRSNAPG PPLHIGASHL PRGAAAAAVM 

       250        260        270        280        290        300 
SSSKVTTVLR PTSQLPNAAT AQPAVQHIIH QPIQSRPPVT TSNAIPPAVV ATVSATRAQS 

       310        320        330        340        350        360 
PVITTTAAHA TDSALSRPTL SIQHPPSAAI SIQRPAQSRD VTTRITLPSH PALGTPKQQL 

       370        380        390        400        410        420 
HTMAQKTIFS TGTPVAAATV APILATNTIP SATTAGSVSH TQAPTSTIVT MTVPSHSSHA 

       430        440        450        460        470        480 
TAVTTSNIPV AKVVPQQITH TSPRIQPDYP AERSSLIPIS GHRASPNPVA METRSDNRPS 

       490        500        510        520        530        540 
VPVQFQYFLP TYPPSAYPLA AHTYTPITSS VSTIRQYPVS AQAPNSAITA QTGVGVASTV 

       550        560        570        580        590        600 
HLNPMQLMTV DASHARHIQG IQPAPISTQG IQPAPIGTPG IQPAPLGTQG IHSATPINTQ 

       610        620        630        640        650        660 
GLQPAPMGTQ QPQPEGKTSA VVLADGATIV ANPISNPFSA APAATTVVQT HSQSASTNAP 

       670        680        690        700        710        720 
AQGSSPRPSI LRKKPATDGA KPKSEIHVSM ATPVTVSMET VSNQNNDQPT IAVPPTAQQP 

       730        740        750        760        770        780 
PPTIPTMIAA ASPPSQPAVA LSTIPGAVPI TPPITTIAAA PPPSVTVGGS LSSVLGPPVP 

       790        800        810        820        830        840 
EIKVKEEVEP MDIMRPVSAV PPLATNTVSP SLALLANNLS MPTSDLPPGA SPRKKPRKQQ 

       850        860        870        880        890        900 
HVISTEEGDM METNSTDDEK STAKSLLVKA EKRKSPPKEY IDEEGVRYVP VRPRPPITLL 

       910        920        930        940        950        960 
RHYRNPWKAA YHHFQRYSDV RVKEEKKAML QEIANQKGVS CRAQGWKVHL CAAQLLQLTN 

       970        980        990       1000       1010       1020 
LEHDVYERLT NLQEGIIPKK KAATDDDLHR INELIQGNMQ RCKLVMDQIS EARDSMLKVL 

      1030       1040 
DHKDRVLKLL NKNGTVKKVS KLKRKEKV 

« Hide

Isoform 2 [UniParc].

Checksum: 6392B91A2F6FCDF5
Show »

FASTA61365,689
Isoform 3 [UniParc].

Checksum: 25C99C93FF72BF0E
Show »

FASTA1,083113,967

References

« Hide 'large scale' references
[1]"Identification and characterization of three new components of the mSin3A corepressor complex."
Fleischer T.C., Yun U.J., Ayer D.E.
Mol. Cell. Biol. 23:3456-3467(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, ACETYLATION, IDENTIFICATION IN A MSIN3A COREPRESSOR COMPLEX WITH SIN3A; SAP130; SUDS3; ARID4B; HDAC1 AND HDAC2.
[2]"Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs."
Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. expand/collapse author list , Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.
Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Testis.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[4]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
[6]"Systematic identification and analysis of mammalian small ubiquitin-like modifier substrates."
Gocke C.B., Yu H., Kang J.
J. Biol. Chem. 280:5004-5012(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: SUMOYLATION WITH SUMO1, SUBCELLULAR LOCATION.
[7]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-355; SER-442 AND SER-875, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[8]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-355; SER-442; SER-855 AND THR-856, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[9]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-856, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY220791 mRNA. Translation: AAO63591.1.
AL136833 mRNA. Translation: CAB66767.1.
AK022823 mRNA. Translation: BAB14261.1.
AC118060 Genomic DNA. Translation: AAX88975.1.
AC012306 Genomic DNA. Translation: AAY14878.1.
BC017453 mRNA. Translation: AAH17453.2.
BC117255 mRNA. Translation: AAI17256.1.
BC143898 mRNA. Translation: AAI43899.1.
RefSeqNP_001139400.1. NM_001145928.1.
NP_078821.2. NM_024545.3.
UniGeneHs.32995.

3D structure databases

ProteinModelPortalQ9H0E3.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid122735. 29 interactions.
IntActQ9H0E3. 5 interactions.
MINTMINT-1185872.
STRING9606.ENSP00000259235.

Chemistry

ChEMBLCHEMBL1229012.

PTM databases

PhosphoSiteQ9H0E3.

Polymorphism databases

DMDM74717977.

Proteomic databases

PaxDbQ9H0E3.
PRIDEQ9H0E3.

Protocols and materials databases

DNASU79595.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000259235; ENSP00000259235; ENSG00000136715. [Q9H0E3-1]
ENST00000357702; ENSP00000350333; ENSG00000136715. [Q9H0E3-3]
GeneID79595.
KEGGhsa:79595.
UCSCuc002tpp.2. human. [Q9H0E3-1]
uc002tpq.1. human. [Q9H0E3-3]

Organism-specific databases

CTD79595.
GeneCardsGC02M128792.
HGNCHGNC:29813. SAP130.
HPAHPA034664.
MIM609697. gene.
neXtProtNX_Q9H0E3.
PharmGKBPA143485608.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG12793.
HOGENOMHOG000081804.
HOVERGENHBG106600.
OMAVSAREHM.
OrthoDBEOG7V1FPT.
PhylomeDBQ9H0E3.
TreeFamTF332685.

Enzyme and pathway databases

ReactomeREACT_172623. Chromatin organization.

Gene expression databases

ArrayExpressQ9H0E3.
BgeeQ9H0E3.
CleanExHS_SAP130.
GenevestigatorQ9H0E3.

Family and domain databases

InterProIPR024137. His_deAcase_cplx_SAP130.
[Graphical view]
PANTHERPTHR13497. PTHR13497. 1 hit.
ProtoNetSearch...

Other

ChiTaRSSap130. human.
GeneWikiSAP130.
GenomeRNAi79595.
NextBio68614.
PROQ9H0E3.
SOURCESearch...

Entry information

Entry nameSP130_HUMAN
AccessionPrimary (citable) accession number: Q9H0E3
Secondary accession number(s): B7ZLM3 expand/collapse secondary AC list , C9K0X9, Q4ZFV4, Q53T46, Q8WVW4, Q9H9G8
Entry history
Integrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: March 1, 2001
Last modified: April 16, 2014
This is version 91 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM