Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9H0E3

- SP130_HUMAN

UniProt

Q9H0E3 - SP130_HUMAN

Protein

Histone deacetylase complex subunit SAP130

Gene

SAP130

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 96 (01 Oct 2014)
      Sequence version 1 (01 Mar 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes.1 Publication

    GO - Molecular functioni

    1. transcription coactivator activity Source: UniProtKB

    GO - Biological processi

    1. chromatin organization Source: Reactome
    2. histone H3 acetylation Source: UniProtKB
    3. negative regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
    4. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Repressor

    Keywords - Biological processi

    Transcription, Transcription regulation

    Enzyme and pathway databases

    ReactomeiREACT_172610. HATs acetylate histones.
    REACT_200856. NoRC negatively regulates rRNA expression.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Histone deacetylase complex subunit SAP130
    Alternative name(s):
    130 kDa Sin3-associated polypeptide
    Sin3-associated polypeptide p130
    Gene namesi
    Name:SAP130
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:29813. SAP130.

    Subcellular locationi

    Nucleus 1 Publication

    GO - Cellular componenti

    1. nucleus Source: HPA
    2. STAGA complex Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA143485608.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 10481048Histone deacetylase complex subunit SAP130PRO_0000283736Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei355 – 3551Phosphothreonine2 Publications
    Modified residuei442 – 4421Phosphoserine2 Publications
    Modified residuei855 – 8551Phosphoserine1 Publication
    Modified residuei856 – 8561Phosphothreonine2 Publications
    Modified residuei875 – 8751Phosphoserine1 Publication

    Post-translational modificationi

    Acetylated.1 Publication
    Sumoylated with SUMO1.1 Publication

    Keywords - PTMi

    Acetylation, Phosphoprotein, Ubl conjugation

    Proteomic databases

    MaxQBiQ9H0E3.
    PaxDbiQ9H0E3.
    PRIDEiQ9H0E3.

    PTM databases

    PhosphoSiteiQ9H0E3.

    Expressioni

    Tissue specificityi

    Expressed in various cancer cell ines.1 Publication

    Gene expression databases

    ArrayExpressiQ9H0E3.
    BgeeiQ9H0E3.
    CleanExiHS_SAP130.
    GenevestigatoriQ9H0E3.

    Organism-specific databases

    HPAiHPA034664.

    Interactioni

    Subunit structurei

    Component of a mSin3A corepressor complex that contains SIN3A, SAP130, SUDS3/SAP45, ARID4B/SAP180, HDAC1 and HDAC2. Interacts (released by dead or dying cells) with CLEC4E By similarity.By similarity

    Protein-protein interaction databases

    BioGridi122735. 29 interactions.
    IntActiQ9H0E3. 5 interactions.
    MINTiMINT-1185872.
    STRINGi9606.ENSP00000259235.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9H0E3.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni836 – 1047212Interactions with SIN3A and HDAC1Add
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi81 – 855Poly-Ser
    Compositional biasi124 – 16946Pro-richAdd
    BLAST
    Compositional biasi234 – 2385Poly-Ala
    Compositional biasi709 – 836128Pro-richAdd
    BLAST

    Domaini

    The N-terminus may interact with a transcriptional coactivator.
    The C-terminus may interact with HDAC-dependent and HDAC-independent corepressors.

    Sequence similaritiesi

    Belongs to the SAP130 family.Curated

    Phylogenomic databases

    eggNOGiNOG12793.
    HOGENOMiHOG000081804.
    HOVERGENiHBG106600.
    OMAiVSAREHM.
    OrthoDBiEOG7V1FPT.
    PhylomeDBiQ9H0E3.
    TreeFamiTF332685.

    Family and domain databases

    InterProiIPR024137. His_deAcase_cplx_SAP130.
    [Graphical view]
    PANTHERiPTHR13497. PTHR13497. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9H0E3-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGPPRHPQAG EIEAGGAGGG RRLQVEMSSQ QFPRLGAPST GLSQAPSQIA     50
    NSGSAGLINP AATVNDESGR DSEVSAREHM SSSSSLQSRE EKQEPVVVRP 100
    YPQVQMLSTH HAVASATPVA VTAPPAHLTP AVPLSFSEGL MKPPPKPTMP 150
    SRPIAPAPPS TLSLPPKVPG QVTVTMESSI PQASAIPVAT ISGQQGHPSN 200
    LHHIMTTNVQ MSIIRSNAPG PPLHIGASHL PRGAAAAAVM SSSKVTTVLR 250
    PTSQLPNAAT AQPAVQHIIH QPIQSRPPVT TSNAIPPAVV ATVSATRAQS 300
    PVITTTAAHA TDSALSRPTL SIQHPPSAAI SIQRPAQSRD VTTRITLPSH 350
    PALGTPKQQL HTMAQKTIFS TGTPVAAATV APILATNTIP SATTAGSVSH 400
    TQAPTSTIVT MTVPSHSSHA TAVTTSNIPV AKVVPQQITH TSPRIQPDYP 450
    AERSSLIPIS GHRASPNPVA METRSDNRPS VPVQFQYFLP TYPPSAYPLA 500
    AHTYTPITSS VSTIRQYPVS AQAPNSAITA QTGVGVASTV HLNPMQLMTV 550
    DASHARHIQG IQPAPISTQG IQPAPIGTPG IQPAPLGTQG IHSATPINTQ 600
    GLQPAPMGTQ QPQPEGKTSA VVLADGATIV ANPISNPFSA APAATTVVQT 650
    HSQSASTNAP AQGSSPRPSI LRKKPATDGA KPKSEIHVSM ATPVTVSMET 700
    VSNQNNDQPT IAVPPTAQQP PPTIPTMIAA ASPPSQPAVA LSTIPGAVPI 750
    TPPITTIAAA PPPSVTVGGS LSSVLGPPVP EIKVKEEVEP MDIMRPVSAV 800
    PPLATNTVSP SLALLANNLS MPTSDLPPGA SPRKKPRKQQ HVISTEEGDM 850
    METNSTDDEK STAKSLLVKA EKRKSPPKEY IDEEGVRYVP VRPRPPITLL 900
    RHYRNPWKAA YHHFQRYSDV RVKEEKKAML QEIANQKGVS CRAQGWKVHL 950
    CAAQLLQLTN LEHDVYERLT NLQEGIIPKK KAATDDDLHR INELIQGNMQ 1000
    RCKLVMDQIS EARDSMLKVL DHKDRVLKLL NKNGTVKKVS KLKRKEKV 1048
    Length:1,048
    Mass (Da):110,324
    Last modified:March 1, 2001 - v1
    Checksum:iEB4E74E35BA07AEE
    GO
    Isoform 2 (identifier: Q9H0E3-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-470: Missing.
         678-678: D → DGMAVRKTLIPPQPPDVASPRVESSMRSTSGSPRPA

    Show »
    Length:613
    Mass (Da):65,689
    Checksum:i6392B91A2F6FCDF5
    GO
    Isoform 3 (identifier: Q9H0E3-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         678-678: D → DGMAVRKTLIPPQPPDVASPRVESSMRSTSGSPRPA

    Note: No experimental confirmation available.

    Show »
    Length:1,083
    Mass (Da):113,967
    Checksum:i25C99C93FF72BF0E
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 470470Missing in isoform 2. 1 PublicationVSP_024355Add
    BLAST
    Alternative sequencei678 – 6781D → DGMAVRKTLIPPQPPDVASP RVESSMRSTSGSPRPA in isoform 2 and isoform 3. 2 PublicationsVSP_024356

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY220791 mRNA. Translation: AAO63591.1.
    AL136833 mRNA. Translation: CAB66767.1.
    AK022823 mRNA. Translation: BAB14261.1.
    AC118060 Genomic DNA. Translation: AAX88975.1.
    AC012306 Genomic DNA. Translation: AAY14878.1.
    BC017453 mRNA. Translation: AAH17453.2.
    BC117255 mRNA. Translation: AAI17256.1.
    BC143898 mRNA. Translation: AAI43899.1.
    CCDSiCCDS2153.1. [Q9H0E3-1]
    CCDS54397.1. [Q9H0E3-3]
    RefSeqiNP_001139400.1. NM_001145928.1. [Q9H0E3-3]
    NP_078821.2. NM_024545.3. [Q9H0E3-1]
    UniGeneiHs.32995.

    Genome annotation databases

    EnsembliENST00000259235; ENSP00000259235; ENSG00000136715. [Q9H0E3-1]
    ENST00000357702; ENSP00000350333; ENSG00000136715. [Q9H0E3-3]
    GeneIDi79595.
    KEGGihsa:79595.
    UCSCiuc002tpp.2. human. [Q9H0E3-1]
    uc002tpq.1. human. [Q9H0E3-3]

    Polymorphism databases

    DMDMi74717977.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY220791 mRNA. Translation: AAO63591.1 .
    AL136833 mRNA. Translation: CAB66767.1 .
    AK022823 mRNA. Translation: BAB14261.1 .
    AC118060 Genomic DNA. Translation: AAX88975.1 .
    AC012306 Genomic DNA. Translation: AAY14878.1 .
    BC017453 mRNA. Translation: AAH17453.2 .
    BC117255 mRNA. Translation: AAI17256.1 .
    BC143898 mRNA. Translation: AAI43899.1 .
    CCDSi CCDS2153.1. [Q9H0E3-1 ]
    CCDS54397.1. [Q9H0E3-3 ]
    RefSeqi NP_001139400.1. NM_001145928.1. [Q9H0E3-3 ]
    NP_078821.2. NM_024545.3. [Q9H0E3-1 ]
    UniGenei Hs.32995.

    3D structure databases

    ProteinModelPortali Q9H0E3.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122735. 29 interactions.
    IntActi Q9H0E3. 5 interactions.
    MINTi MINT-1185872.
    STRINGi 9606.ENSP00000259235.

    Chemistry

    ChEMBLi CHEMBL1229012.

    PTM databases

    PhosphoSitei Q9H0E3.

    Polymorphism databases

    DMDMi 74717977.

    Proteomic databases

    MaxQBi Q9H0E3.
    PaxDbi Q9H0E3.
    PRIDEi Q9H0E3.

    Protocols and materials databases

    DNASUi 79595.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000259235 ; ENSP00000259235 ; ENSG00000136715 . [Q9H0E3-1 ]
    ENST00000357702 ; ENSP00000350333 ; ENSG00000136715 . [Q9H0E3-3 ]
    GeneIDi 79595.
    KEGGi hsa:79595.
    UCSCi uc002tpp.2. human. [Q9H0E3-1 ]
    uc002tpq.1. human. [Q9H0E3-3 ]

    Organism-specific databases

    CTDi 79595.
    GeneCardsi GC02M128792.
    HGNCi HGNC:29813. SAP130.
    HPAi HPA034664.
    MIMi 609697. gene.
    neXtProti NX_Q9H0E3.
    PharmGKBi PA143485608.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG12793.
    HOGENOMi HOG000081804.
    HOVERGENi HBG106600.
    OMAi VSAREHM.
    OrthoDBi EOG7V1FPT.
    PhylomeDBi Q9H0E3.
    TreeFami TF332685.

    Enzyme and pathway databases

    Reactomei REACT_172610. HATs acetylate histones.
    REACT_200856. NoRC negatively regulates rRNA expression.

    Miscellaneous databases

    ChiTaRSi Sap130. human.
    GeneWikii SAP130.
    GenomeRNAii 79595.
    NextBioi 68614.
    PROi Q9H0E3.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9H0E3.
    Bgeei Q9H0E3.
    CleanExi HS_SAP130.
    Genevestigatori Q9H0E3.

    Family and domain databases

    InterProi IPR024137. His_deAcase_cplx_SAP130.
    [Graphical view ]
    PANTHERi PTHR13497. PTHR13497. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Identification and characterization of three new components of the mSin3A corepressor complex."
      Fleischer T.C., Yun U.J., Ayer D.E.
      Mol. Cell. Biol. 23:3456-3467(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, ACETYLATION, IDENTIFICATION IN A MSIN3A COREPRESSOR COMPLEX WITH SIN3A; SAP130; SUDS3; ARID4B; HDAC1 AND HDAC2.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Testis.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    6. "Systematic identification and analysis of mammalian small ubiquitin-like modifier substrates."
      Gocke C.B., Yu H., Kang J.
      J. Biol. Chem. 280:5004-5012(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUMOYLATION WITH SUMO1, SUBCELLULAR LOCATION.
    7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-355; SER-442 AND SER-875, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-355; SER-442; SER-855 AND THR-856, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-856, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiSP130_HUMAN
    AccessioniPrimary (citable) accession number: Q9H0E3
    Secondary accession number(s): B7ZLM3
    , C9K0X9, Q4ZFV4, Q53T46, Q8WVW4, Q9H9G8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 3, 2007
    Last sequence update: March 1, 2001
    Last modified: October 1, 2014
    This is version 96 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3