Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Histone deacetylase complex subunit SAP130

Gene

SAP130

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes.1 Publication

GO - Biological processi

  • negative regulation of transcription by RNA polymerase II Source: BHF-UCL
  • transcription, DNA-templated Source: UniProtKB-KW

Keywordsi

Molecular functionRepressor
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-HSA-3214847 HATs acetylate histones
R-HSA-427413 NoRC negatively regulates rRNA expression

Names & Taxonomyi

Protein namesi
Recommended name:
Histone deacetylase complex subunit SAP130
Alternative name(s):
130 kDa Sin3-associated polypeptide
Sin3-associated polypeptide p130
Gene namesi
Name:SAP130
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000136715.17
HGNCiHGNC:29813 SAP130
MIMi609697 gene
neXtProtiNX_Q9H0E3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi79595
OpenTargetsiENSG00000136715
PharmGKBiPA143485608

Chemistry databases

ChEMBLiCHEMBL1229012

Polymorphism and mutation databases

BioMutaiSAP130
DMDMi74717977

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002837361 – 1048Histone deacetylase complex subunit SAP130Add BLAST1048

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei232Omega-N-methylarginineCombined sources1
Modified residuei355PhosphothreonineCombined sources1
Modified residuei442PhosphoserineCombined sources1
Modified residuei465PhosphoserineCombined sources1
Cross-linki785Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei855PhosphoserineCombined sources1
Modified residuei856PhosphothreonineCombined sources1
Cross-linki864Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki869Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei875PhosphoserineCombined sources1

Post-translational modificationi

Acetylated.1 Publication
Sumoylated with SUMO1.1 Publication

Keywords - PTMi

Acetylation, Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ9H0E3
MaxQBiQ9H0E3
PaxDbiQ9H0E3
PeptideAtlasiQ9H0E3
PRIDEiQ9H0E3

PTM databases

iPTMnetiQ9H0E3
PhosphoSitePlusiQ9H0E3

Expressioni

Tissue specificityi

Expressed in various cancer cell ines.1 Publication

Gene expression databases

BgeeiENSG00000136715
CleanExiHS_SAP130
ExpressionAtlasiQ9H0E3 baseline and differential
GenevisibleiQ9H0E3 HS

Organism-specific databases

HPAiHPA034664

Interactioni

Subunit structurei

Component of a mSin3A corepressor complex that contains SIN3A, SAP130, SUDS3/SAP45, ARID4B/SAP180, HDAC1 and HDAC2. Interacts (released by dead or dying cells) with CLEC4E (By similarity).By similarity

Protein-protein interaction databases

BioGridi122735, 54 interactors
CORUMiQ9H0E3
IntActiQ9H0E3, 14 interactors
MINTiQ9H0E3
STRINGi9606.ENSP00000350333

Structurei

3D structure databases

ProteinModelPortaliQ9H0E3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni836 – 1047Interactions with SIN3A and HDAC1Add BLAST212

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi81 – 85Poly-Ser5
Compositional biasi124 – 169Pro-richAdd BLAST46
Compositional biasi234 – 238Poly-Ala5
Compositional biasi709 – 836Pro-richAdd BLAST128

Domaini

The N-terminus may interact with a transcriptional coactivator.
The C-terminus may interact with HDAC-dependent and HDAC-independent corepressors.

Sequence similaritiesi

Belongs to the SAP130 family.Curated

Phylogenomic databases

eggNOGiENOG410IJKN Eukaryota
ENOG410ZRAM LUCA
GeneTreeiENSGT00440000037733
HOGENOMiHOG000081804
HOVERGENiHBG106600
InParanoidiQ9H0E3
KOiK19192
OMAiSTIVTMT
OrthoDBiEOG091G01LU
PhylomeDBiQ9H0E3
TreeFamiTF332685

Family and domain databases

InterProiView protein in InterPro
IPR024137 His_deAcase_cplx_SAP130
IPR031963 SAP130_C
PANTHERiPTHR13497 PTHR13497, 1 hit
PfamiView protein in Pfam
PF16014 SAP130_C, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H0E3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGPPRHPQAG EIEAGGAGGG RRLQVEMSSQ QFPRLGAPST GLSQAPSQIA
60 70 80 90 100
NSGSAGLINP AATVNDESGR DSEVSAREHM SSSSSLQSRE EKQEPVVVRP
110 120 130 140 150
YPQVQMLSTH HAVASATPVA VTAPPAHLTP AVPLSFSEGL MKPPPKPTMP
160 170 180 190 200
SRPIAPAPPS TLSLPPKVPG QVTVTMESSI PQASAIPVAT ISGQQGHPSN
210 220 230 240 250
LHHIMTTNVQ MSIIRSNAPG PPLHIGASHL PRGAAAAAVM SSSKVTTVLR
260 270 280 290 300
PTSQLPNAAT AQPAVQHIIH QPIQSRPPVT TSNAIPPAVV ATVSATRAQS
310 320 330 340 350
PVITTTAAHA TDSALSRPTL SIQHPPSAAI SIQRPAQSRD VTTRITLPSH
360 370 380 390 400
PALGTPKQQL HTMAQKTIFS TGTPVAAATV APILATNTIP SATTAGSVSH
410 420 430 440 450
TQAPTSTIVT MTVPSHSSHA TAVTTSNIPV AKVVPQQITH TSPRIQPDYP
460 470 480 490 500
AERSSLIPIS GHRASPNPVA METRSDNRPS VPVQFQYFLP TYPPSAYPLA
510 520 530 540 550
AHTYTPITSS VSTIRQYPVS AQAPNSAITA QTGVGVASTV HLNPMQLMTV
560 570 580 590 600
DASHARHIQG IQPAPISTQG IQPAPIGTPG IQPAPLGTQG IHSATPINTQ
610 620 630 640 650
GLQPAPMGTQ QPQPEGKTSA VVLADGATIV ANPISNPFSA APAATTVVQT
660 670 680 690 700
HSQSASTNAP AQGSSPRPSI LRKKPATDGA KPKSEIHVSM ATPVTVSMET
710 720 730 740 750
VSNQNNDQPT IAVPPTAQQP PPTIPTMIAA ASPPSQPAVA LSTIPGAVPI
760 770 780 790 800
TPPITTIAAA PPPSVTVGGS LSSVLGPPVP EIKVKEEVEP MDIMRPVSAV
810 820 830 840 850
PPLATNTVSP SLALLANNLS MPTSDLPPGA SPRKKPRKQQ HVISTEEGDM
860 870 880 890 900
METNSTDDEK STAKSLLVKA EKRKSPPKEY IDEEGVRYVP VRPRPPITLL
910 920 930 940 950
RHYRNPWKAA YHHFQRYSDV RVKEEKKAML QEIANQKGVS CRAQGWKVHL
960 970 980 990 1000
CAAQLLQLTN LEHDVYERLT NLQEGIIPKK KAATDDDLHR INELIQGNMQ
1010 1020 1030 1040
RCKLVMDQIS EARDSMLKVL DHKDRVLKLL NKNGTVKKVS KLKRKEKV
Length:1,048
Mass (Da):110,324
Last modified:March 1, 2001 - v1
Checksum:iEB4E74E35BA07AEE
GO
Isoform 2 (identifier: Q9H0E3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-470: Missing.
     678-678: D → DGMAVRKTLIPPQPPDVASPRVESSMRSTSGSPRPA

Show »
Length:613
Mass (Da):65,689
Checksum:i6392B91A2F6FCDF5
GO
Isoform 3 (identifier: Q9H0E3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     678-678: D → DGMAVRKTLIPPQPPDVASPRVESSMRSTSGSPRPA

Note: No experimental confirmation available.
Show »
Length:1,083
Mass (Da):113,967
Checksum:i25C99C93FF72BF0E
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0243551 – 470Missing in isoform 2. 1 PublicationAdd BLAST470
Alternative sequenceiVSP_024356678D → DGMAVRKTLIPPQPPDVASP RVESSMRSTSGSPRPA in isoform 2 and isoform 3. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY220791 mRNA Translation: AAO63591.1
AL136833 mRNA Translation: CAB66767.1
AK022823 mRNA Translation: BAB14261.1
AC118060 Genomic DNA Translation: AAX88975.1
AC012306 Genomic DNA Translation: AAY14878.1
BC017453 mRNA Translation: AAH17453.2
BC117255 mRNA Translation: AAI17256.1
BC143898 mRNA Translation: AAI43899.1
CCDSiCCDS2153.1 [Q9H0E3-1]
CCDS54397.1 [Q9H0E3-3]
RefSeqiNP_001139400.1, NM_001145928.1 [Q9H0E3-3]
NP_001317228.1, NM_001330299.1
NP_078821.2, NM_024545.3 [Q9H0E3-1]
UniGeneiHs.32995

Genome annotation databases

EnsembliENST00000259235; ENSP00000259235; ENSG00000136715 [Q9H0E3-1]
ENST00000357702; ENSP00000350333; ENSG00000136715 [Q9H0E3-3]
GeneIDi79595
KEGGihsa:79595
UCSCiuc002tpp.3 human [Q9H0E3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSP130_HUMAN
AccessioniPrimary (citable) accession number: Q9H0E3
Secondary accession number(s): B7ZLM3
, C9K0X9, Q4ZFV4, Q53T46, Q8WVW4, Q9H9G8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: March 1, 2001
Last modified: May 23, 2018
This is version 129 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health