Reviewed,
UniProtKB/Swiss-Prot Q9H0A8 (COMD4_HUMAN)
Last modified
November 24, 2009.
Version 59.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · General annotation (Comments) · Ontologies · Binary interactions · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: COMM domain-containing protein 4 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 199 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| PTM | Phosphoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Cellular component | cytoplasm Inferred from direct assay. Source: LIFEdb |
| Molecular function | protein binding Ref.1 Inferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9H0A8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9H0A8-2) The sequence of this isoform differs from the canonical sequence as follows: 128-187: MNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAE → K |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 199 | 199 | COMM domain-containing protein 4 | PRO_0000077393 | |||||
Regions | |||||||||
| Domain | 130 – 199 | 70 | COMM | ||||||
Amino acid modifications | |||||||||
| Modified residue | 115 | 1 | Phosphoserine Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 128 – 187 | 60 | MNRLA…VLLAE → K in isoform 2. | VSP_011394 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "COMMD proteins, a novel family of structural and functional homologs of MURR1." Burstein E., Hoberg J.E., Wilkinson A.S., Rumble J.M., Csomos R.A., Komarck C.M., Maine G.N., Wilkinson J.C., Mayo M.W., Duckett C.S. J. Biol. Chem. 280:22222-22232(2005) [PubMed: 15799966] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed: 11230166] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Testis. |
| [3] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Prostate. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Cervix and Mammary gland. |
| [7] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-115, MASS SPECTROMETRY. |
| [8] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
Cross-references
Sequence databases | |
|---|---|
| AY542160 mRNA. Translation: AAS22242.1. AL136872 mRNA. Translation: CAB66806.1. CR533452 mRNA. Translation: CAG38483.1. AK000459 mRNA. Translation: BAA91178.1. AK314740 mRNA. Translation: BAG37281.1. CH471136 Genomic DNA. Translation: EAW99263.1. BC000837 mRNA. Translation: AAH00837.2. BC068998 mRNA. Translation: AAH68998.1. | |
| IPI | IPI00413500. IPI00456702. |
| RefSeq | NP_060298.2. |
| UniGene | Hs.351327 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9H0A8. 4 interactions. |
| STRING | Q9H0A8. |
PTM databases | |
| PhosphoSite | Q9H0A8. |
Proteomic databases | |
| PRIDE | Q9H0A8. |
Genome annotation databases | |
| Ensembl | ENST00000267935; ENSP00000267935; ENSG00000140365; Homo sapiens. [Genome view] |
| GeneID | 54939. |
| KEGG | hsa:54939. |
| UCSC | uc002azy.1. human. uc002baa.1. human. |
Organism-specific databases | |
| CTD | 54939. |
| GeneCards | GC15P073415. |
| HGNC | HGNC:26027. COMMD4. |
| PharmGKB | PA134993083. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | Q9H0A8. |
| HOVERGEN | Q9H0A8. |
| OMA | KFQVLLA |
| OrthoDB | EOG97DD1Z |
Gene expression databases | |
| ArrayExpress | Q9H0A8. |
| Bgee | Q9H0A8. |
| CleanEx | HS_COMMD4. |
| Genevestigator | Q9H0A8. |
| GermOnline | ENSG00000140365. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR017920. COMM. IPR009886. HCaRG. [Graphical view] |
| Pfam | PF07258. HCaRG. 1 hit. [Graphical view] |
| PROSITE | PS51269. COMM. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 58066. |
Entry information
| Entry name | COMD4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H0A8 Secondary accession number(s): B2RBN4, Q7L637, Q9NX43 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with


