Q9H0A8 (COMD4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 74.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: COMM domain-containing protein 4 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 199 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Down-regulates activation of NF-kappa-B. Ref.1 |
| Subunit structure | Interacts (via COMM domain) with COMMD1 (via COMM domain). Ref.1 |
| Tissue specificity | Ubiquitous. Ref.1 |
| Sequence similarities | Contains 1 COMM domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | cytoplasm Inferred from direct assay. Source: LIFEdb |
| Molecular function | protein binding Inferred from physical interaction Ref.1. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| COMMD1 | Q8N668 | 2 | EBI-1550064,EBI-1550112 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9H0A8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9H0A8-2) The sequence of this isoform differs from the canonical sequence as follows: 128-187: MNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAE → K |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 199 | 199 | COMM domain-containing protein 4 | PRO_0000077393 | |||||
Regions | |||||||||
| Domain | 130 – 199 | 70 | COMM | ||||||
Amino acid modifications | |||||||||
| Modified residue | 115 | 1 | Phosphoserine Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 128 – 187 | 60 | MNRLA…VLLAE → K in isoform 2. | VSP_011394 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "COMMD proteins, a novel family of structural and functional homologs of MURR1." Burstein E., Hoberg J.E., Wilkinson A.S., Rumble J.M., Csomos R.A., Komarck C.M., Maine G.N., Wilkinson J.C., Mayo M.W., Duckett C.S. J. Biol. Chem. 280:22222-22232(2005) [PubMed: 15799966] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH COMMD1, TISSUE SPECIFICITY. |
| [2] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed: 11230166] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Testis. |
| [3] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Prostate. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Cervix and Mammary gland. |
| [7] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-115, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY542160 mRNA. Translation: AAS22242.1. AL136872 mRNA. Translation: CAB66806.1. CR533452 mRNA. Translation: CAG38483.1. AK000459 mRNA. Translation: BAA91178.1. AK314740 mRNA. Translation: BAG37281.1. CH471136 Genomic DNA. Translation: EAW99263.1. BC000837 mRNA. Translation: AAH00837.2. BC068998 mRNA. Translation: AAH68998.1. |
| IPI | IPI00413500. IPI00456702. |
| RefSeq | NP_060298.2. NM_017828.3. |
| UniGene | Hs.351327. |
3D structure databases | |
| ProteinModelPortal | Q9H0A8. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9H0A8. 6 interactions. |
| STRING | Q9H0A8. |
PTM databases | |
| PhosphoSite | Q9H0A8. |
Polymorphism databases | |
| DMDM | 51316094. |
Proteomic databases | |
| PRIDE | Q9H0A8. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000267935; ENSP00000267935; ENSG00000140365. |
| GeneID | 54939. |
| KEGG | hsa:54939. |
| UCSC | uc002azy.1. human. uc002baa.1. human. |
Organism-specific databases | |
| CTD | 54939. |
| GeneCards | GC15P075628. |
| H-InvDB | HIX0012439. |
| HGNC | HGNC:26027. COMMD4. |
| neXtProt | NX_Q9H0A8. |
| PharmGKB | PA134993083. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG19927. |
| GeneTree | ENSGT00390000015516. |
| HOGENOM | HBG610249. |
| HOVERGEN | HBG051069. |
| InParanoid | Q9H0A8. |
| OMA | RSVEEPM. |
| OrthoDB | EOG45X7XJ. |
| PhylomeDB | Q9H0A8. |
Gene expression databases | |
| ArrayExpress | Q9H0A8. |
| Bgee | Q9H0A8. |
| CleanEx | HS_COMMD4. |
| Genevestigator | Q9H0A8. |
| GermOnline | ENSG00000140365. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR017920. COMM. IPR009886. HCaRG. [Graphical view] |
| Pfam | PF07258. HCaRG. 1 hit. [Graphical view] |
| PROSITE | PS51269. COMM. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 58066. |
Entry information
| Entry name | COMD4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H0A8 Secondary accession number(s): B2RBN4, Q7L637, Q9NX43 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with