Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger MYND domain-containing protein 15

Gene

ZMYND15

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Acts as a transcriptional repressor through interaction with histone deacetylases (HDACs). May be important for spermiogenesis.1 PublicationBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri313 – 35947MYND-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Differentiation, Spermatogenesis, Transcription, Transcription regulation

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger MYND domain-containing protein 15
Gene namesi
Name:ZMYND15
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:20997. ZMYND15.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Involvement in diseasei

Spermatogenic failure 14 (SPGF14)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder resulting in the absence (azoospermia) or reduction (oligozoospermia) of sperm in the semen, leading to male infertility.
See also OMIM:615842

Organism-specific databases

MalaCardsiZMYND15.
MIMi615842. phenotype.
Orphaneti399805. Male infertility with azoospermia or oligozoospermia due to single gene mutation.
PharmGKBiPA134873463.

Polymorphism and mutation databases

BioMutaiZMYND15.
DMDMi374095468.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 742742Zinc finger MYND domain-containing protein 15PRO_0000218317Add
BLAST

Proteomic databases

PaxDbiQ9H091.
PRIDEiQ9H091.

Expressioni

Gene expression databases

BgeeiQ9H091.
CleanExiHS_ZMYND15.
GenevisibleiQ9H091. HS.

Interactioni

Subunit structurei

Interacts with HDAC1, HDAC3, HDAC6 and, to a lesser extent, with HDAC7.By similarity

Structurei

3D structure databases

ProteinModelPortaliQ9H091.
SMRiQ9H091. Positions 312-362.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi110 – 18677Glu-richAdd
BLAST
Compositional biasi707 – 72418Pro-richAdd
BLAST

Sequence similaritiesi

Contains 1 MYND-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri313 – 35947MYND-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiENOG410IMI3. Eukaryota.
ENOG4111I8B. LUCA.
GeneTreeiENSGT00390000000527.
HOGENOMiHOG000231040.
HOVERGENiHBG064225.
InParanoidiQ9H091.
OMAiWFRKFVA.
OrthoDBiEOG74N5G5.
PhylomeDBiQ9H091.
TreeFamiTF336410.

Family and domain databases

InterProiIPR002893. Znf_MYND.
[Graphical view]
PfamiPF01753. zf-MYND. 1 hit.
[Graphical view]
PROSITEiPS50865. ZF_MYND_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H091-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEFVSGYRDE FLDFTALLFG WFRKFVAERG AVGTSLEGRC RQLEAQIRRL
60 70 80 90 100
PQDPALWVLH VLPNHSVGIS LGQGAEPGPG PGLGTAWLLG DNPPLHLRDL
110 120 130 140 150
SPYISFVSLE DGEEGEEEEE EDEEEEKRED GGAGSTEKVE PEEDRELAPT
160 170 180 190 200
SRESPQETNP PGESEEAARE AGGGKDGCRE DRVENETRPQ KRKGQRSEAA
210 220 230 240 250
PLHVSCLLLV TDEHGTILGI DLLVDGAQGT ASWGSGTKDL APWAYALLCH
260 270 280 290 300
SMACPMGSGD PRKPRQLTVG DARLHRELES LVPRLGVKLA KTPMRTWGPR
310 320 330 340 350
PGFTFASLRA RTCHVCHRHS FEAKLTPCPQ CSAVLYCGEA CLRADWQRCP
360 370 380 390 400
DDVSHRFWCP RLAAFMERAG ELATLPFTYT AEVTSETFNK EAFLASRGLT
410 420 430 440 450
RGYWTQLSML IPGPGFSRHP RGNTPSLSLL RGGDPYQLLQ GDGTALMPPV
460 470 480 490 500
PPHPPRGVFG SWQDYYTWRG LSLDSPIAVL LTYPLTVYYV ITHLVPQSFP
510 520 530 540 550
ELNIQNKQSL KIHVVEAGKE FDLVMVFWEL LVLLPHVALE LQFVGDGLPP
560 570 580 590 600
ESDEQHFTLQ RDSLEVSVRP GSGISARPSS GTKEKGGRRD LQIKVSARPY
610 620 630 640 650
HLFQGPKPDL VIGFNSGFAL KDTWLRSLPR LQSLRVPAFF TESSEYSCVM
660 670 680 690 700
DGQTMAVATG GGTSPPQPNP FRSPFRLRAA DNCMSWYCNA FIFHLVYKPA
710 720 730 740
QGSGARPAPG PPPPSPTPSA PPAPTRRRRG EKKPGRGARR RK
Length:742
Mass (Da):81,860
Last modified:January 25, 2012 - v2
Checksum:i88667EFB2B621CAF
GO
Isoform 2 (identifier: Q9H091-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     460-499: GSWQDYYTWRGLSLDSPIAVLLTYPLTVYYVITHLVPQSF → V

Show »
Length:703
Mass (Da):77,313
Checksum:i52ED9BF9113C1932
GO
Isoform 3 (identifier: Q9H091-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     612-612: I → IASPSSLSA

Note: No experimental confirmation available.
Show »
Length:750
Mass (Da):82,560
Checksum:i83126FA97C1E311B
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti401 – 4011R → H.
Corresponds to variant rs35005394 [ dbSNP | Ensembl ].
VAR_052992

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei460 – 49940GSWQD…VPQSF → V in isoform 2. 1 PublicationVSP_042144Add
BLAST
Alternative sequencei612 – 6121I → IASPSSLSA in isoform 3. 1 PublicationVSP_047208

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK302181 mRNA. Translation: BAG63547.1.
AL136893 mRNA. Translation: CAB66827.1.
AC091153 Genomic DNA. No translation available.
CH471108 Genomic DNA. Translation: EAW90414.1.
BC067296 mRNA. No translation available.
CCDSiCCDS11053.1. [Q9H091-2]
CCDS45584.1. [Q9H091-1]
CCDS58506.1. [Q9H091-3]
RefSeqiNP_001129518.1. NM_001136046.2. [Q9H091-1]
NP_001254751.1. NM_001267822.1. [Q9H091-3]
NP_115641.1. NM_032265.2. [Q9H091-2]
UniGeneiHs.47223.
Hs.742549.

Genome annotation databases

EnsembliENST00000269289; ENSP00000269289; ENSG00000141497. [Q9H091-3]
ENST00000433935; ENSP00000391742; ENSG00000141497. [Q9H091-1]
ENST00000573751; ENSP00000459501; ENSG00000141497. [Q9H091-3]
ENST00000592813; ENSP00000465435; ENSG00000141497. [Q9H091-2]
GeneIDi84225.
KEGGihsa:84225.
UCSCiuc002fyt.4. human. [Q9H091-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK302181 mRNA. Translation: BAG63547.1.
AL136893 mRNA. Translation: CAB66827.1.
AC091153 Genomic DNA. No translation available.
CH471108 Genomic DNA. Translation: EAW90414.1.
BC067296 mRNA. No translation available.
CCDSiCCDS11053.1. [Q9H091-2]
CCDS45584.1. [Q9H091-1]
CCDS58506.1. [Q9H091-3]
RefSeqiNP_001129518.1. NM_001136046.2. [Q9H091-1]
NP_001254751.1. NM_001267822.1. [Q9H091-3]
NP_115641.1. NM_032265.2. [Q9H091-2]
UniGeneiHs.47223.
Hs.742549.

3D structure databases

ProteinModelPortaliQ9H091.
SMRiQ9H091. Positions 312-362.
ModBaseiSearch...
MobiDBiSearch...

Polymorphism and mutation databases

BioMutaiZMYND15.
DMDMi374095468.

Proteomic databases

PaxDbiQ9H091.
PRIDEiQ9H091.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000269289; ENSP00000269289; ENSG00000141497. [Q9H091-3]
ENST00000433935; ENSP00000391742; ENSG00000141497. [Q9H091-1]
ENST00000573751; ENSP00000459501; ENSG00000141497. [Q9H091-3]
ENST00000592813; ENSP00000465435; ENSG00000141497. [Q9H091-2]
GeneIDi84225.
KEGGihsa:84225.
UCSCiuc002fyt.4. human. [Q9H091-1]

Organism-specific databases

CTDi84225.
GeneCardsiZMYND15.
HGNCiHGNC:20997. ZMYND15.
MalaCardsiZMYND15.
MIMi614312. gene.
615842. phenotype.
neXtProtiNX_Q9H091.
Orphaneti399805. Male infertility with azoospermia or oligozoospermia due to single gene mutation.
PharmGKBiPA134873463.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IMI3. Eukaryota.
ENOG4111I8B. LUCA.
GeneTreeiENSGT00390000000527.
HOGENOMiHOG000231040.
HOVERGENiHBG064225.
InParanoidiQ9H091.
OMAiWFRKFVA.
OrthoDBiEOG74N5G5.
PhylomeDBiQ9H091.
TreeFamiTF336410.

Miscellaneous databases

ChiTaRSiZMYND15. human.
GenomeRNAii84225.
NextBioi73670.
PROiQ9H091.
SOURCEiSearch...

Gene expression databases

BgeeiQ9H091.
CleanExiHS_ZMYND15.
GenevisibleiQ9H091. HS.

Family and domain databases

InterProiIPR002893. Znf_MYND.
[Graphical view]
PfamiPF01753. zf-MYND. 1 hit.
[Graphical view]
PROSITEiPS50865. ZF_MYND_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
  6. "Truncating mutations in TAF4B and ZMYND15 causing recessive azoospermia."
    Ayhan O., Balkan M., Guven A., Hazan R., Atar M., Tok A., Tolun A.
    J. Med. Genet. 51:239-244(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN SPGF14, POSSIBLE FUNCTION.

Entry informationi

Entry nameiZMY15_HUMAN
AccessioniPrimary (citable) accession number: Q9H091
Secondary accession number(s): B4DXY5, I3L296
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 16, 2003
Last sequence update: January 25, 2012
Last modified: March 16, 2016
This is version 102 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.