Reviewed,
UniProtKB/Swiss-Prot Q9H013 (ADA19_HUMAN)
Last modified
December 15, 2009.
Version 94.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Disintegrin and metalloproteinase domain-containing protein 19 Short name=ADAM 19 EC=3.4.24.- Alternative name(s): Meltrin-beta Metalloprotease and disintegrin dendritic antigen marker Short name=MADDAM | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 956 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Participates in the proteolytic processing of beta-type neuregulin isoforms which are involved in neurogenesis and synaptogenesis, suggesting a regulatory role in glial cell. Also cleaves alpha-2 macroglobulin. May be involved in osteoblast differentiation and/or osteoblast activity in bone By similarity. |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Subunit structure | Interacts with SH3PXD2A. Ref.5 |
| Subcellular location | |
| Tissue specificity | Expressed in many normal organ tissues and several cancer cell lines. |
| Induction | By 1,25(OH)2VD3 in monocytes. |
| Domain | The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. |
| Post-translational modification | The precursor is cleaved by a furin endopeptidase By similarity. |
| Sequence similarities | Contains 1 disintegrin domain. Contains 1 EGF-like domain. Contains 1 peptidase M12B domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | EGF-like domain SH3-binding Signal Transmembrane |
| Ligand | Metal-binding Zinc |
| Molecular function | Hydrolase Metalloprotease Protease |
| PTM | Disulfide bond Glycoprotein Zymogen |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | proteolysis Inferred from electronic annotation. Source: InterPro |
| Cellular component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | SH3 domain binding Inferred from electronic annotation. Source: UniProtKB-KW metalloendopeptidase activityInferred from electronic annotation. Source: InterPro zinc ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: Q9H013-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: Q9H013-2) The sequence of this isoform differs from the canonical sequence as follows: 903-956: VSPREALKVKAGTRGLQGGRCRVEKTKQFMLLVVWTELPEQKPRAKHSCFLVPA → FPEYRSQRAGGMISSKI |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 25 | 25 | Potential | ||||||||
| Propeptide | 26 – 203 | 178 | By similarity | PRO_0000029102 | |||||||
| Chain | 204 – 956 | 753 | Disintegrin and metalloproteinase domain-containing protein 19 | PRO_0000029103 | |||||||
Regions | |||||||||||
| Topological domain | 204 – 700 | 497 | Extracellular Potential | ||||||||
| Transmembrane | 701 – 721 | 21 | Potential | ||||||||
| Topological domain | 722 – 956 | 235 | Cytoplasmic Potential | ||||||||
| Domain | 211 – 409 | 199 | Peptidase M12B | ||||||||
| Domain | 417 – 503 | 87 | Disintegrin | ||||||||
| Domain | 651 – 683 | 33 | EGF-like | ||||||||
| Motif | 131 – 138 | 8 | Cysteine switch By similarity | ||||||||
| Motif | 834 – 840 | 7 | SH3-binding Potential | ||||||||
| Motif | 839 – 845 | 7 | SH3-binding Potential | ||||||||
| Compositional bias | 435 – 438 | 4 | Poly-Glu | ||||||||
| Compositional bias | 503 – 650 | 148 | Cys-rich | ||||||||
Sites | |||||||||||
| Active site | 347 | 1 | By similarity | ||||||||
| Metal binding | 133 | 1 | Zinc; in inhibited form By similarity | ||||||||
| Metal binding | 346 | 1 | Zinc; catalytic By similarity | ||||||||
| Metal binding | 350 | 1 | Zinc; catalytic By similarity | ||||||||
| Metal binding | 356 | 1 | Zinc; catalytic By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 145 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 445 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 448 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 646 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 321 ↔ 404 | By similarity | |||||||||
| Disulfide bond | 361 ↔ 388 | By similarity | |||||||||
| Disulfide bond | 362 ↔ 371 | By similarity | |||||||||
| Disulfide bond | 475 ↔ 495 | By similarity | |||||||||
| Disulfide bond | 655 ↔ 665 | By similarity | |||||||||
| Disulfide bond | 659 ↔ 671 | By similarity | |||||||||
| Disulfide bond | 673 ↔ 682 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 903 – 956 | 54 | VSPRE…FLVPA → FPEYRSQRAGGMISSKI in isoform B. | VSP_005481 | |||||||
| Natural variant | 4 | 1 | G → S: dbSNP rs11465228. Ref.2 | VAR_057066 | |||||||
| Natural variant | 134 | 1 | R → Q in a colorectal cancer sample; somatic mutation. Ref.6 | VAR_036146 | |||||||
| Natural variant | 299 | 1 | A → T in a colorectal cancer sample; somatic mutation. Ref.6 | VAR_036147 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 32 – 33 | 2 | SK → R Ref.2 | ||||||||
| Sequence conflict | 32 – 33 | 2 | SK → R Ref.3 | ||||||||
| Sequence conflict | 558 | 1 | V → D Ref.2 | ||||||||
| Sequence conflict | 558 | 1 | V → D Ref.3 | ||||||||
| Sequence conflict | 623 | 1 | N → D Ref.2 | ||||||||
| Sequence conflict | 623 | 1 | N → D Ref.3 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of FKSG34, a novel human gene encoding for metalloprotease-disintegrin meltrin beta." Wang Y.-G., Gong L. Submitted (DEC-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A). |
| [2] | "Molecular cloning and characterization of a human metalloprotease disintegrin a novel marker for dendritic cell differentiation." Fritsche J., Moser M., Faust S., Peuker A., Buettner R., Andreesen R., Kreutz M. Blood 96:732-739(2000) [PubMed: 10887142] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B), VARIANT SER-4. Tissue: Lymph node. |
| [3] | "Expression and enzymatic activity of human disintegrin and metalloproteinase ADAM19/meltrin beta." Wei P., Zhao Y.-G., Zhuang L., Ruben S., Sang Q.-X.A. Biochem. Biophys. Res. Commun. 280:744-755(2001) [PubMed: 11162584] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B). Tissue: Dendritic cell. |
| [4] | "Partial sequence of Homo sapiens ADAM19." Xu R., Cai J., Ying B., Wang F., Xu T., Zhao S., Li C. Submitted (MAR-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 100-956 (ISOFORM A). |
| [5] | "The adaptor protein fish associates with members of the ADAMs family and localizes to podosomes of Src-transformed cells." Abram C.L., Seals D.F., Pass I., Salinsky D., Maurer L., Roth T.M., Courtneidge S.A. J. Biol. Chem. 278:16844-16851(2003) [PubMed: 12615925] [Abstract] Cited for: INTERACTION WITH SH3PXD2A. |
| [6] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] GLN-134 AND THR-299. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF326918 mRNA. Translation: AAG50282.1. Y13786 mRNA. Translation: CAC20585.1. AF311317 mRNA. Translation: AAK07852.1. AF134707 mRNA. Translation: AAF22162.1. | |
| IPI | IPI00011901. IPI00249735. |
| RefSeq | NP_150377.1. |
| UniGene | Hs.483944 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9H013. |
Protein family/group databases | |
| MEROPS | M12.214. |
Proteomic databases | |
| PRIDE | Q9H013. |
Genome annotation databases | |
| Ensembl | ENST00000432888; ENSP00000410266; ENSG00000135074; Homo sapiens. [Genome view] |
| GeneID | 8728. |
| KEGG | hsa:8728. |
| UCSC | uc003lwz.1. human. |
Organism-specific databases | |
| CTD | 8728. |
| GeneCards | GC05M156836. |
| HGNC | HGNC:197. ADAM19. |
| MIM | 603640. gene. |
| PharmGKB | PA24514. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q9H013. |
| InParanoid | Q9H013. |
Gene expression databases | |
| ArrayExpress | Q9H013. |
| Bgee | Q9H013. |
| CleanEx | HS_ADAM19. |
| Genevestigator | Q9H013. |
| GermOnline | ENSG00000135074. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR006586. ADAM_Cys-rich. IPR001762. Blood-coag_inhib_Disintegrin. IPR018358. Disintegrin_CS. IPR013032. EGF-like_reg_CS. IPR000742. EGF_3. IPR013111. EGF_extracell. IPR001590. Peptidase_M12B. IPR002870. Peptidase_M12B_N. [Graphical view] |
| Gene3D | G3DSA:4.10.70.10. Blood-coag_inhib_Disintegrin. 1 hit. |
| Pfam | PF08516. ADAM_CR. 1 hit. PF00200. Disintegrin. 1 hit. PF07974. EGF_2. 1 hit. PF01562. Pep_M12B_propep. 1 hit. PF01421. Reprolysin. 1 hit. [Graphical view] |
| PRINTS | PR00289. DISINTEGRIN. |
| SMART | SM00608. ACR. 1 hit. SM00050. DISIN. 1 hit. [Graphical view] |
| PROSITE | PS50215. ADAM_MEPRO. 1 hit. PS00546. CYSTEINE_SWITCH. False negative. PS00427. DISINTEGRIN_1. 1 hit. PS50214. DISINTEGRIN_2. 1 hit. PS00022. EGF_1. False negative. PS01186. EGF_2. 1 hit. PS50026. EGF_3. 1 hit. PS00142. ZINC_PROTEASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 32743. |
| SOURCE | Search... |
Entry information
| Entry name | ADA19_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9H013 Secondary accession number(s): Q9BZL5, Q9UHP2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| Peptidase families Classification of peptidase families and list of entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with


