Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9GZT6 (CC90B_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 85. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Coiled-coil domain-containing protein 90B, mitochondrial
Gene names
Name:CCDC90B
ORF Names:CUA003, MDS011, MDS025
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length254 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Subcellular location

Mitochondrion. Membrane; Single-pass membrane protein Potential Ref.7.

Sequence similarities

Belongs to the CCDC90 family.

Ontologies

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9GZT6-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9GZT6-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MNSRQAWRLFLSQGRGDRWVSRPRGHFSPALRR → MLANCGSVCEETQFRGTTVAPALG

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Transit peptide1 – 4242Mitochondrion Potential
Chain43 – 254212Coiled-coil domain-containing protein 90B, mitochondrial
PRO_0000295695

Regions

Transmembrane231 – 25323Helical; Potential
Coiled coil129 – 16436 Potential

Natural variations

Alternative sequence1 – 3333MNSRQ…PALRR → MLANCGSVCEETQFRGTTVA PALG in isoform 2.
VSP_027003
Natural variant101F → L. Ref.2 Ref.4
Corresponds to variant rs494791 [ dbSNP | Ensembl ].
VAR_033322

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified April 20, 2010. Version 2.
Checksum: 773DB2E66AB6C921

FASTA25429,506
        10         20         30         40         50         60 
MNSRQAWRLF LSQGRGDRWV SRPRGHFSPA LRREFFTTTT KEGYDRRPVD ITPLEQRKLT 

        70         80         90        100        110        120 
FDTHALVQDL ETHGFDKTQA ETIVSALTAL SNVSLDTIYK EMVTQAQQEI TVQQLMAHLD 

       130        140        150        160        170        180 
AIRKDMVILE KSEFANLRAE NEKMKIELDQ VKQQLMHETS RIRADNKLDI NLERSRVTDM 

       190        200        210        220        230        240 
FTDQEKQLME TTTEFTKKDT QTKSIISETS NKIDAEIASL KTLMESNKLE TIRYLAASVF 

       250 
TCLAIALGFY RFWK 

« Hide

Isoform 2 [UniParc].

Checksum: F24AE980B00734B4
Show »

FASTA24527,979

References

« Hide 'large scale' references
[1]"Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs."
Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. expand/collapse author list , Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.
Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Testis.
[2]"Novel genes expressed in hematopoietic stem/progenitor cells from Myelodysplastic syndromes patient."
Huang C., Qian B., Tu Y., Gu W., Wang Y., Han Z., Chen Z.
Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LEU-10.
[3]Xu X., Yang Y., Gao G., Xiao H., Chen Z., Han Z.
Submitted (MAY-2000) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Adrenal tumor.
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT LEU-10.
Tissue: Testis and Uterus.
[5]"Human chromosome 11 DNA sequence and analysis including novel gene identification."
Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. expand/collapse author list , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.
Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Testis and Urinary bladder.
[7]"Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing."
Simpson J.C., Wellenreuther R., Poustka A., Pepperkok R., Wiemann S.
EMBO Rep. 1:287-292(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION.
[8]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AL136791 mRNA. Translation: CAB66725.1.
AF182412 mRNA. Translation: AAG14948.1.
AF182424 mRNA. Translation: AAG14960.1.
AF271782 mRNA. Translation: AAG44793.1.
AK292349 mRNA. Translation: BAF85038.1.
AK304769 mRNA. Translation: BAG65524.1.
AP000873 Genomic DNA. No translation available.
BC014573 mRNA. Translation: AAH14573.1.
BC020783 mRNA. Translation: AAH20783.1.
BC107755 mRNA. Translation: AAI07756.1.
RefSeqNP_001273045.1. NM_001286116.1.
NP_001273046.1. NM_001286117.1.
NP_001273047.1. NM_001286118.1.
NP_001273048.1. NM_001286119.1.
NP_001273049.1. NM_001286120.1.
NP_068597.2. NM_021825.4.
UniGeneHs.368866.

3D structure databases

ProteinModelPortalQ9GZT6.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid121923. 29 interactions.
IntActQ9GZT6. 33 interactions.
MINTMINT-1381437.
STRING9606.ENSP00000260054.

PTM databases

PhosphoSiteQ9GZT6.

Polymorphism databases

DMDM294862420.

Proteomic databases

PaxDbQ9GZT6.
PRIDEQ9GZT6.

Protocols and materials databases

DNASU60492.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000455220; ENSP00000390990; ENSG00000137500. [Q9GZT6-2]
ENST00000529689; ENSP00000434724; ENSG00000137500. [Q9GZT6-1]
GeneID60492.
KEGGhsa:60492.
UCSCuc001pac.3. human. [Q9GZT6-1]
uc001paf.3. human. [Q9GZT6-2]

Organism-specific databases

CTD60492.
GeneCardsGC11M082972.
H-InvDBHIX0009991.
HGNCHGNC:28108. CCDC90B.
HPAHPA011130.
HPA011931.
neXtProtNX_Q9GZT6.
PharmGKBPA162381967.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG297085.
HOGENOMHOG000294135.
HOVERGENHBG107611.
InParanoidQ9GZT6.
OMAQLEQVKF.
OrthoDBEOG7SR4NS.
PhylomeDBQ9GZT6.
TreeFamTF331442.

Gene expression databases

ArrayExpressQ9GZT6.
BgeeQ9GZT6.
CleanExHS_CCDC90B.
GenevestigatorQ9GZT6.

Family and domain databases

InterProIPR012439. Coiled-coil-containing_90.
IPR024461. DUF1640.
[Graphical view]
PANTHERPTHR14360:SF1. PTHR14360:SF1. 1 hit.
PfamPF07798. DUF1640. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSCCDC90B. human.
GeneWikiCCDC90B.
GenomeRNAi60492.
NextBio65387.
PROQ9GZT6.

Entry information

Entry nameCC90B_HUMAN
AccessionPrimary (citable) accession number: Q9GZT6
Secondary accession number(s): A8K8I4 expand/collapse secondary AC list , B4E3L2, Q3B781, Q9GZU6
Entry history
Integrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: April 20, 2010
Last modified: March 19, 2014
This is version 85 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 11

Human chromosome 11: entries, gene names and cross-references to MIM