Q9GZT6 (CC90B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 79.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Coiled-coil domain-containing protein 90B, mitochondrial | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 254 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subcellular location | Mitochondrion. Membrane; Single-pass membrane protein Potential Ref.7. |
| Sequence similarities | Belongs to the CCDC90 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane Mitochondrion |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil Transit peptide Transmembrane Transmembrane helix |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW mitochondrionInferred from direct assay. Source: LIFEdb |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9GZT6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9GZT6-2) The sequence of this isoform differs from the canonical sequence as follows: 1-33: MNSRQAWRLFLSQGRGDRWVSRPRGHFSPALRR → MLANCGSVCEETQFRGTTVAPALG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 42 | 42 | Mitochondrion Potential | ||||||
| Chain | 43 – 254 | 212 | Coiled-coil domain-containing protein 90B, mitochondrial | PRO_0000295695 | |||||
Regions | |||||||||
| Transmembrane | 231 – 253 | 23 | Helical; Potential | ||||||
| Coiled coil | 129 – 164 | 36 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 33 | 33 | MNSRQ…PALRR → MLANCGSVCEETQFRGTTVA PALG in isoform 2. | VSP_027003 | |||||
| Natural variant | 10 | 1 | F → L. Ref.2 Ref.4 Corresponds to variant rs494791 [ dbSNP | Ensembl ]. | VAR_033322 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Testis. |
| [2] | "Novel genes expressed in hematopoietic stem/progenitor cells from Myelodysplastic syndromes patient." Huang C., Qian B., Tu Y., Gu W., Wang Y., Han Z., Chen Z. Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LEU-10. |
| [3] | Xu X., Yang Y., Gao G., Xiao H., Chen Z., Han Z. Submitted (MAY-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Adrenal tumor. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT LEU-10. Tissue: Testis and Uterus. |
| [5] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Testis and Urinary bladder. |
| [7] | "Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing." Simpson J.C., Wellenreuther R., Poustka A., Pepperkok R., Wiemann S. EMBO Rep. 1:287-292(2000) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [8] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AL136791 mRNA. Translation: CAB66725.1. AF182412 mRNA. Translation: AAG14948.1. AF182424 mRNA. Translation: AAG14960.1. AF271782 mRNA. Translation: AAG44793.1. AK292349 mRNA. Translation: BAF85038.1. AK304769 mRNA. Translation: BAG65524.1. AP000873 Genomic DNA. No translation available. BC014573 mRNA. Translation: AAH14573.1. BC020783 mRNA. Translation: AAH20783.1. BC107755 mRNA. Translation: AAI07756.1. |
| IPI | IPI00549236. IPI00854851. |
| RefSeq | NP_068597.2. NM_021825.3. |
| UniGene | Hs.368866. |
3D structure databases | |
| ProteinModelPortal | Q9GZT6. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9GZT6. 28 interactions. |
| MINT | MINT-1381437. |
| STRING | 9606.ENSP00000260054. |
PTM databases | |
| PhosphoSite | Q9GZT6. |
Polymorphism databases | |
| DMDM | 294862420. |
Proteomic databases | |
| PaxDb | Q9GZT6. |
| PRIDE | Q9GZT6. |
Protocols and materials databases | |
| DNASU | 60492. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000455220; ENSP00000390990; ENSG00000137500. ENST00000529689; ENSP00000434724; ENSG00000137500. |
| GeneID | 60492. |
| KEGG | hsa:60492. |
| UCSC | uc001pac.3. human. uc001paf.3. human. |
Organism-specific databases | |
| CTD | 60492. |
| GeneCards | GC11M082972. |
| H-InvDB | HIX0009991. |
| HGNC | HGNC:28108. CCDC90B. |
| HPA | HPA011130. HPA011931. |
| neXtProt | NX_Q9GZT6. |
| PharmGKB | PA162381967. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG297085. |
| HOGENOM | HOG000294135. |
| HOVERGEN | HBG107611. |
| InParanoid | Q9GZT6. |
| OMA | AASVFTC. |
| PhylomeDB | Q9GZT6. |
Gene expression databases | |
| ArrayExpress | Q9GZT6. |
| Bgee | Q9GZT6. |
| CleanEx | HS_CCDC90B. |
| Genevestigator | Q9GZT6. |
Family and domain databases | |
| InterPro | IPR012439. Coiled-coil-containing_90. IPR024461. DUF1640. [Graphical view] |
| PANTHER | PTHR14360:SF1. PTHR14360:SF1. 1 hit. |
| Pfam | PF07798. DUF1640. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | CCDC90B. human. |
| GenomeRNAi | 60492. |
| NextBio | 65387. |
Entry information
| Entry name | CC90B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9GZT6 Secondary accession number(s): A8K8I4 Q9GZU6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
