Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9GZT6

- CC90B_HUMAN

UniProt

Q9GZT6 - CC90B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Coiled-coil domain-containing protein 90B, mitochondrial

Gene

CCDC90B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Coiled-coil domain-containing protein 90B, mitochondrial
Gene namesi
Name:CCDC90B
ORF Names:CUA003, MDS011, MDS025
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:28108. CCDC90B.

Subcellular locationi

Mitochondrion 1 Publication. Membrane Curated; Single-pass membrane protein Curated

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei231 – 25323HelicalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. mitochondrion Source: LIFEdb
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Mitochondrion

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162381967.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transit peptidei1 – 4242MitochondrionSequence AnalysisAdd
BLAST
Chaini43 – 254212Coiled-coil domain-containing protein 90B, mitochondrialPRO_0000295695Add
BLAST

Proteomic databases

MaxQBiQ9GZT6.
PaxDbiQ9GZT6.
PRIDEiQ9GZT6.

PTM databases

PhosphoSiteiQ9GZT6.

Expressioni

Gene expression databases

BgeeiQ9GZT6.
CleanExiHS_CCDC90B.
ExpressionAtlasiQ9GZT6. baseline and differential.
GenevestigatoriQ9GZT6.

Organism-specific databases

HPAiHPA011130.
HPA011931.

Interactioni

Protein-protein interaction databases

BioGridi121923. 30 interactions.
IntActiQ9GZT6. 33 interactions.
MINTiMINT-1381437.
STRINGi9606.ENSP00000260054.

Structurei

3D structure databases

ProteinModelPortaliQ9GZT6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili129 – 16436Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Belongs to the CCDC90 family.Curated

Keywords - Domaini

Coiled coil, Transit peptide, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG297085.
GeneTreeiENSGT00390000016409.
HOGENOMiHOG000294135.
HOVERGENiHBG107611.
InParanoidiQ9GZT6.
OMAiQLEQVKF.
OrthoDBiEOG7SR4NS.
PhylomeDBiQ9GZT6.
TreeFamiTF331442.

Family and domain databases

InterProiIPR024461. DUF1640.
[Graphical view]
PfamiPF07798. DUF1640. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9GZT6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNSRQAWRLF LSQGRGDRWV SRPRGHFSPA LRREFFTTTT KEGYDRRPVD
60 70 80 90 100
ITPLEQRKLT FDTHALVQDL ETHGFDKTQA ETIVSALTAL SNVSLDTIYK
110 120 130 140 150
EMVTQAQQEI TVQQLMAHLD AIRKDMVILE KSEFANLRAE NEKMKIELDQ
160 170 180 190 200
VKQQLMHETS RIRADNKLDI NLERSRVTDM FTDQEKQLME TTTEFTKKDT
210 220 230 240 250
QTKSIISETS NKIDAEIASL KTLMESNKLE TIRYLAASVF TCLAIALGFY

RFWK
Length:254
Mass (Da):29,506
Last modified:April 20, 2010 - v2
Checksum:i773DB2E66AB6C921
GO
Isoform 2 (identifier: Q9GZT6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MNSRQAWRLFLSQGRGDRWVSRPRGHFSPALRR → MLANCGSVCEETQFRGTTVAPALG

Show »
Length:245
Mass (Da):27,979
Checksum:iF24AE980B00734B4
GO
Isoform 3 (identifier: Q9GZT6-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-101: Missing.

Note: No experimental confirmation available.

Show »
Length:153
Mass (Da):17,812
Checksum:iECAB99D950D543D8
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti10 – 101F → L.2 Publications
Corresponds to variant rs494791 [ dbSNP | Ensembl ].
VAR_033322

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 101101Missing in isoform 3. 1 PublicationVSP_055663Add
BLAST
Alternative sequencei1 – 3333MNSRQ…PALRR → MLANCGSVCEETQFRGTTVA PALG in isoform 2. 2 PublicationsVSP_027003Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136791 mRNA. Translation: CAB66725.1.
AF182412 mRNA. Translation: AAG14948.1.
AF182424 mRNA. Translation: AAG14960.1.
AF271782 mRNA. Translation: AAG44793.1.
AK055972 mRNA. Translation: BAG51599.1.
AK292349 mRNA. Translation: BAF85038.1.
AK304769 mRNA. Translation: BAG65524.1.
AP000873 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW75089.1.
CH471076 Genomic DNA. Translation: EAW75091.1.
BC014573 mRNA. Translation: AAH14573.1.
BC020783 mRNA. Translation: AAH20783.1.
BC107755 mRNA. Translation: AAI07756.1.
CCDSiCCDS66190.1. [Q9GZT6-3]
CCDS66191.1. [Q9GZT6-2]
CCDS8266.1. [Q9GZT6-1]
RefSeqiNP_001273045.1. NM_001286116.1. [Q9GZT6-2]
NP_001273046.1. NM_001286117.1. [Q9GZT6-3]
NP_001273047.1. NM_001286118.1.
NP_001273048.1. NM_001286119.1.
NP_001273049.1. NM_001286120.1.
NP_068597.2. NM_021825.4. [Q9GZT6-1]
XP_005274216.1. XM_005274159.1. [Q9GZT6-3]
XP_006718717.1. XM_006718654.1. [Q9GZT6-3]
UniGeneiHs.368866.

Genome annotation databases

EnsembliENST00000455220; ENSP00000390990; ENSG00000137500. [Q9GZT6-2]
ENST00000525503; ENSP00000431424; ENSG00000137500. [Q9GZT6-3]
ENST00000529611; ENSP00000431345; ENSG00000137500. [Q9GZT6-3]
ENST00000529689; ENSP00000434724; ENSG00000137500. [Q9GZT6-1]
GeneIDi60492.
KEGGihsa:60492.
UCSCiuc001pac.3. human. [Q9GZT6-1]
uc001paf.3. human. [Q9GZT6-2]

Polymorphism databases

DMDMi294862420.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136791 mRNA. Translation: CAB66725.1 .
AF182412 mRNA. Translation: AAG14948.1 .
AF182424 mRNA. Translation: AAG14960.1 .
AF271782 mRNA. Translation: AAG44793.1 .
AK055972 mRNA. Translation: BAG51599.1 .
AK292349 mRNA. Translation: BAF85038.1 .
AK304769 mRNA. Translation: BAG65524.1 .
AP000873 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW75089.1 .
CH471076 Genomic DNA. Translation: EAW75091.1 .
BC014573 mRNA. Translation: AAH14573.1 .
BC020783 mRNA. Translation: AAH20783.1 .
BC107755 mRNA. Translation: AAI07756.1 .
CCDSi CCDS66190.1. [Q9GZT6-3 ]
CCDS66191.1. [Q9GZT6-2 ]
CCDS8266.1. [Q9GZT6-1 ]
RefSeqi NP_001273045.1. NM_001286116.1. [Q9GZT6-2 ]
NP_001273046.1. NM_001286117.1. [Q9GZT6-3 ]
NP_001273047.1. NM_001286118.1.
NP_001273048.1. NM_001286119.1.
NP_001273049.1. NM_001286120.1.
NP_068597.2. NM_021825.4. [Q9GZT6-1 ]
XP_005274216.1. XM_005274159.1. [Q9GZT6-3 ]
XP_006718717.1. XM_006718654.1. [Q9GZT6-3 ]
UniGenei Hs.368866.

3D structure databases

ProteinModelPortali Q9GZT6.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 121923. 30 interactions.
IntActi Q9GZT6. 33 interactions.
MINTi MINT-1381437.
STRINGi 9606.ENSP00000260054.

PTM databases

PhosphoSitei Q9GZT6.

Polymorphism databases

DMDMi 294862420.

Proteomic databases

MaxQBi Q9GZT6.
PaxDbi Q9GZT6.
PRIDEi Q9GZT6.

Protocols and materials databases

DNASUi 60492.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000455220 ; ENSP00000390990 ; ENSG00000137500 . [Q9GZT6-2 ]
ENST00000525503 ; ENSP00000431424 ; ENSG00000137500 . [Q9GZT6-3 ]
ENST00000529611 ; ENSP00000431345 ; ENSG00000137500 . [Q9GZT6-3 ]
ENST00000529689 ; ENSP00000434724 ; ENSG00000137500 . [Q9GZT6-1 ]
GeneIDi 60492.
KEGGi hsa:60492.
UCSCi uc001pac.3. human. [Q9GZT6-1 ]
uc001paf.3. human. [Q9GZT6-2 ]

Organism-specific databases

CTDi 60492.
GeneCardsi GC11M082972.
H-InvDB HIX0009991.
HGNCi HGNC:28108. CCDC90B.
HPAi HPA011130.
HPA011931.
neXtProti NX_Q9GZT6.
PharmGKBi PA162381967.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG297085.
GeneTreei ENSGT00390000016409.
HOGENOMi HOG000294135.
HOVERGENi HBG107611.
InParanoidi Q9GZT6.
OMAi QLEQVKF.
OrthoDBi EOG7SR4NS.
PhylomeDBi Q9GZT6.
TreeFami TF331442.

Miscellaneous databases

ChiTaRSi CCDC90B. human.
GeneWikii CCDC90B.
GenomeRNAii 60492.
NextBioi 35469184.
PROi Q9GZT6.

Gene expression databases

Bgeei Q9GZT6.
CleanExi HS_CCDC90B.
ExpressionAtlasi Q9GZT6. baseline and differential.
Genevestigatori Q9GZT6.

Family and domain databases

InterProi IPR024461. DUF1640.
[Graphical view ]
Pfami PF07798. DUF1640. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  2. "Novel genes expressed in hematopoietic stem/progenitor cells from Myelodysplastic syndromes patient."
    Huang C., Qian B., Tu Y., Gu W., Wang Y., Han Z., Chen Z.
    Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LEU-10.
  3. Xu X., Yang Y., Gao G., Xiao H., Chen Z., Han Z.
    Submitted (MAY-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Adrenal tumor.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), VARIANT LEU-10.
    Tissue: Testis and Uterus.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Testis and Urinary bladder.
  8. "Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing."
    Simpson J.C., Wellenreuther R., Poustka A., Pepperkok R., Wiemann S.
    EMBO Rep. 1:287-292(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiCC90B_HUMAN
AccessioniPrimary (citable) accession number: Q9GZT6
Secondary accession number(s): A8K8I4
, B3KP87, B4E3L2, Q3B781, Q9GZU6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: April 20, 2010
Last modified: October 29, 2014
This is version 91 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3