Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9GZM7 (TINAL_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 112. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Tubulointerstitial nephritis antigen-like
Alternative name(s):
Glucocorticoid-inducible protein 5
Oxidized LDL-responsive gene 2 protein
Short name=OLRG-2
Tubulointerstitial nephritis antigen-related protein
Short name=TIN Ag-related protein
Short name=TIN-Ag-RP
Gene names
Name:TINAGL1
Synonyms:GIS5, LCN7, OLRG2, TINAGL
ORF Names:PP6614, PSEC0088, UNQ204/PRO230
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length467 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells. This is a non catalytic peptidase C1 family protein By similarity.

Subcellular location

Secreted Ref.1 Ref.2.

Tissue specificity

Highly expressed in aorta, heart, placenta, kidney and a colorectal adenocarcinoma cell line. Moderately expressed in skeletal muscle, pancreas, lung, lymph nodes, adrenal gland, bone marrow and thyroid. Weakly expressed in colon, small intestine, ovary, spleen, testis and prostate. Predominantly found in vascular smooth muscle cells, but also in cardiac and skeletal muscle cells as well as kidney. Ref.2

Post-translational modification

Glycosylated. Ref.2

Sequence similarities

Belongs to the peptidase C1 family.

Contains 1 SMB (somatomedin-B) domain.

Sequence caution

The sequence AAH09048.1 differs from that shown. Reason: Erroneous initiation.

The sequence BAB55403.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9GZM7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9GZM7-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-134: Missing.
     135-194: CDQEPCLVDP...SSVMNMHEIY → MVLGSSTQVK...EADRATFILQ
     286-286: G → GYAATGDVGREEGKELRGHGLGHDALSLSAFAPSCCLCR
     365-381: ALMEVHEDFFLYKGGIY → GKPPYPAPWFQKLVPA
     382-467: Missing.
Isoform 3 (identifier: Q9GZM7-3)

The sequence of this isoform differs from the canonical sequence as follows:
     126-156: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2121 Ref.2 Ref.13
Chain22 – 467446Tubulointerstitial nephritis antigen-like
PRO_0000026482

Regions

Domain50 – 9849SMB

Amino acid modifications

Glycosylation781N-linked (GlcNAc...) Ref.14
Glycosylation1611N-linked (GlcNAc...) Ref.14
Disulfide bond54 ↔ 73Alternate By similarity
Disulfide bond71 ↔ 85Alternate By similarity
Disulfide bond71 ↔ 73Alternate By similarity
Disulfide bond77 ↔ 84 By similarity
Disulfide bond85 ↔ 92Alternate By similarity

Natural variations

Alternative sequence1 – 134134Missing in isoform 2.
VSP_013094
Alternative sequence126 – 15631Missing in isoform 3.
VSP_043712
Alternative sequence135 – 19460CDQEP…MHEIY → MVLGSSTQVKIGGSWNPAAA GGLKIKLQKALDLVALQCQW APEGQARAEQEADRATFILQ in isoform 2.
VSP_013095
Alternative sequence2861G → GYAATGDVGREEGKELRGHG LGHDALSLSAFAPSCCLCR in isoform 2.
VSP_013096
Alternative sequence365 – 38117ALMEV…KGGIY → GKPPYPAPWFQKLVPA in isoform 2.
VSP_013097
Alternative sequence382 – 46786Missing in isoform 2.
VSP_013098
Natural variant691A → S.
Corresponds to variant rs17497479 [ dbSNP | Ensembl ].
VAR_051514

Experimental info

Sequence conflict3331N → Y in AAL55753. Ref.7
Sequence conflict3771K → E in BAB55403. Ref.8

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 1, 2001. Version 1.
Checksum: E9D72220E3E7B7D5

FASTA46752,387
        10         20         30         40         50         60 
MWRCPLGLLL LLPLAGHLAL GAQQGRGRRE LAPGLHLRGI RDAGGRYCQE QDLCCRGRAD 

        70         80         90        100        110        120 
DCALPYLGAI CYCDLFCNRT VSDCCPDFWD FCLGVPPPFP PIQGCMHGGR IYPVLGTYWD 

       130        140        150        160        170        180 
NCNRCTCQEN RQWQCDQEPC LVDPDMIKAI NQGNYGWQAG NHSAFWGMTL DEGIRYRLGT 

       190        200        210        220        230        240 
IRPSSSVMNM HEIYTVLNPG EVLPTAFEAS EKWPNLIHEP LDQGNCAGSW AFSTAAVASD 

       250        260        270        280        290        300 
RVSIHSLGHM TPVLSPQNLL SCDTHQQQGC RGGRLDGAWW FLRRRGVVSD HCYPFSGRER 

       310        320        330        340        350        360 
DEAGPAPPCM MHSRAMGRGK RQATAHCPNS YVNNNDIYQV TPVYRLGSND KEIMKELMEN 

       370        380        390        400        410        420 
GPVQALMEVH EDFFLYKGGI YSHTPVSLGR PERYRRHGTH SVKITGWGEE TLPDGRTLKY 

       430        440        450        460 
WTAANSWGPA WGERGHFRIV RGVNECDIES FVLGVWGRVG MEDMGHH 

« Hide

Isoform 2 [UniParc].

Checksum: E389D4425C84FB08
Show »

FASTA28430,845
Isoform 3 [UniParc].

Checksum: E66031AF51808DCD
Show »

FASTA43648,807

References

« Hide 'large scale' references
[1]"Cloning, characterization, and expression of the human TIN-ag-RP gene encoding a novel putative extracellular matrix protein."
Broemme N.C., Wex T., Wex H., Levy B., Lipyansky A., Broemme D.
Biochem. Biophys. Res. Commun. 271:474-480(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1), SUBCELLULAR LOCATION.
Tissue: Muscle.
[2]"TIN-ag-RP, a novel catalytically inactive cathepsin B-related protein with EGF domains, is predominantly expressed in vascular smooth muscle cells."
Wex T., Lipyansky A., Broemme N.C., Wex H., Guan X.Q., Broemme D.
Biochemistry 40:1350-1357(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 22-27, TISSUE SPECIFICITY, GLYCOSYLATION, SUBCELLULAR LOCATION.
Tissue: Muscle.
[3]"Identification of oxidized-LDL responsive gene 2 (OLRG-2), encoding a novel extracellular matrix protein in vascular endothelial cells."
Zhang K.M., Chen B.S.
Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[4]"Identification of a novel glucocorticoid-inducible cDNA partially homologous to tubulointerstitial nephritis antigen."
Yoshida H., Takaishi K., Harada M., Nagasaka T., Tsurufuji S., Taniguchi M.
Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1).
[5]"The nucleotide sequence of a long cDNA clone isolated from human spleen."
Jikuya H., Takano J., Nomura N., Kikuno R., Nagase T., Ohara O.
Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Placenta.
[6]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[7]"Large-scale cDNA transfection screening for genes related to cancer development and progression."
Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X. expand/collapse author list , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[8]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
Tissue: Kidney, Placenta and Trachea.
[9]"Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries."
Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y. expand/collapse author list , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.
DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Placenta.
[10]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[11]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[12]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Colon and Pancreas.
[13]"Signal peptide prediction based on analysis of experimentally verified cleavage sites."
Zhang Z., Henzel W.J.
Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 22-36.
[14]"Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-78 AND ASN-161.
Tissue: Liver.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF236155 expand/collapse EMBL AC list , AF236151, AF236152, AF236153, AF236154 Genomic DNA. Translation: AAG40154.1.
AF236150 mRNA. Translation: AAG38876.1.
AF205436 mRNA. Translation: AAG33699.1.
AB050716 mRNA. Translation: BAB18636.1.
AB050719 Genomic DNA. Translation: BAB18727.1.
AK074124 mRNA. Translation: BAB84950.1.
AY358421 mRNA. Translation: AAQ88787.1.
AF289569 mRNA. Translation: AAL55753.1.
AK027839 mRNA. Translation: BAB55403.1. Different initiation.
AK292770 mRNA. Translation: BAF85459.1.
AK298382 mRNA. Translation: BAG60618.1.
AK075398 mRNA. Translation: BAC11596.1.
AC114488 Genomic DNA. No translation available.
CH471059 Genomic DNA. Translation: EAX07604.1.
CH471059 Genomic DNA. Translation: EAX07605.1.
CH471059 Genomic DNA. Translation: EAX07606.1.
BC009048 mRNA. Translation: AAH09048.1. Different initiation.
BC064633 mRNA. Translation: AAH64633.1.
CCDSCCDS343.1. [Q9GZM7-1]
CCDS55586.1. [Q9GZM7-3]
RefSeqNP_001191343.1. NM_001204414.1. [Q9GZM7-3]
NP_001191344.1. NM_001204415.1.
NP_071447.1. NM_022164.2. [Q9GZM7-1]
UniGeneHs.199368.

3D structure databases

ProteinModelPortalQ9GZM7.
SMRQ9GZM7. Positions 145-454.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid122078. 9 interactions.
IntActQ9GZM7. 52 interactions.
MINTMINT-253718.
STRING9606.ENSP00000271064.

Protein family/group databases

MEROPSC01.975.

PTM databases

PhosphoSiteQ9GZM7.

Polymorphism databases

DMDM61213628.

Proteomic databases

MaxQBQ9GZM7.
PaxDbQ9GZM7.
PRIDEQ9GZM7.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000271064; ENSP00000271064; ENSG00000142910. [Q9GZM7-1]
ENST00000457433; ENSP00000395137; ENSG00000142910. [Q9GZM7-3]
GeneID64129.
KEGGhsa:64129.
UCSCuc001bta.3. human. [Q9GZM7-1]
uc010ogj.2. human. [Q9GZM7-3]

Organism-specific databases

CTD64129.
GeneCardsGC01P032042.
HGNCHGNC:19168. TINAGL1.
HPAHPA048695.
neXtProtNX_Q9GZM7.
PharmGKBPA38810.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG310046.
HOGENOMHOG000241342.
HOVERGENHBG053961.
InParanoidQ9GZM7.
OMADNCNRCT.
OrthoDBEOG7SV0V1.
PhylomeDBQ9GZM7.
TreeFamTF313765.

Gene expression databases

ArrayExpressQ9GZM7.
BgeeQ9GZM7.
CleanExHS_TINAGL1.
GenevestigatorQ9GZM7.

Family and domain databases

InterProIPR025660. Pept_his_AS.
IPR013128. Peptidase_C1A.
IPR000668. Peptidase_C1A_C.
IPR001212. Somatomedin_B_dom.
[Graphical view]
PANTHERPTHR12411. PTHR12411. 1 hit.
PfamPF00112. Peptidase_C1. 1 hit.
[Graphical view]
SMARTSM00645. Pept_C1. 1 hit.
SM00201. SO. 1 hit.
[Graphical view]
PROSITEPS00524. SMB_1. 1 hit.
PS50958. SMB_2. 1 hit.
PS00639. THIOL_PROTEASE_HIS. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSTINAGL1. human.
GeneWikiTINAGL1.
GenomeRNAi64129.
NextBio66016.
PROQ9GZM7.

Entry information

Entry nameTINAL_HUMAN
AccessionPrimary (citable) accession number: Q9GZM7
Secondary accession number(s): A8K9Q5 expand/collapse secondary AC list , B4DPK6, D3DPN8, Q8TEJ9, Q8WZ23, Q96GZ4, Q96JW3
Entry history
Integrated into UniProtKB/Swiss-Prot: March 15, 2005
Last sequence update: March 1, 2001
Last modified: July 9, 2014
This is version 112 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Peptidase families

Classification of peptidase families and list of entries

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM