Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9GZM7

- TINAL_HUMAN

UniProt

Q9GZM7 - TINAL_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Tubulointerstitial nephritis antigen-like

Gene

TINAGL1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells. This is a non catalytic peptidase C1 family protein (By similarity).By similarity

GO - Molecular functioni

  1. cysteine-type peptidase activity Source: InterPro
  2. extracellular matrix structural constituent Source: UniProtKB
  3. polysaccharide binding Source: InterPro
  4. scavenger receptor activity Source: InterPro

GO - Biological processi

  1. endosomal transport Source: UniProtKB
  2. immune response Source: InterPro
Complete GO annotation...

Protein family/group databases

MEROPSiC01.975.

Names & Taxonomyi

Protein namesi
Recommended name:
Tubulointerstitial nephritis antigen-like
Alternative name(s):
Glucocorticoid-inducible protein 5
Oxidized LDL-responsive gene 2 protein
Short name:
OLRG-2
Tubulointerstitial nephritis antigen-related protein
Short name:
TIN Ag-related protein
Short name:
TIN-Ag-RP
Gene namesi
Name:TINAGL1
Synonyms:GIS5, LCN7, OLRG2, TINAGL
ORF Names:PP6614, PSEC0088, UNQ204/PRO230
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:19168. TINAGL1.

Subcellular locationi

Secreted 2 Publications

GO - Cellular componenti

  1. cytoplasm Source: Ensembl
  2. extracellular region Source: UniProtKB
  3. extracellular space Source: BHF-UCL
  4. extracellular vesicular exosome Source: UniProt
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38810.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 21212 PublicationsAdd
BLAST
Chaini22 – 467446Tubulointerstitial nephritis antigen-likePRO_0000026482Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi54 ↔ 73AlternatePROSITE-ProRule annotation
Disulfide bondi71 ↔ 85AlternatePROSITE-ProRule annotation
Disulfide bondi71 ↔ 73AlternatePROSITE-ProRule annotation
Disulfide bondi77 ↔ 84PROSITE-ProRule annotation
Glycosylationi78 – 781N-linked (GlcNAc...)1 Publication
Disulfide bondi85 ↔ 92AlternatePROSITE-ProRule annotation
Glycosylationi161 – 1611N-linked (GlcNAc...)1 Publication

Post-translational modificationi

Glycosylated.2 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ9GZM7.
PaxDbiQ9GZM7.
PRIDEiQ9GZM7.

PTM databases

PhosphoSiteiQ9GZM7.

Expressioni

Tissue specificityi

Highly expressed in aorta, heart, placenta, kidney and a colorectal adenocarcinoma cell line. Moderately expressed in skeletal muscle, pancreas, lung, lymph nodes, adrenal gland, bone marrow and thyroid. Weakly expressed in colon, small intestine, ovary, spleen, testis and prostate. Predominantly found in vascular smooth muscle cells, but also in cardiac and skeletal muscle cells as well as kidney.1 Publication

Gene expression databases

BgeeiQ9GZM7.
CleanExiHS_TINAGL1.
ExpressionAtlasiQ9GZM7. baseline and differential.
GenevestigatoriQ9GZM7.

Organism-specific databases

HPAiHPA048695.

Interactioni

Protein-protein interaction databases

BioGridi122078. 15 interactions.
IntActiQ9GZM7. 52 interactions.
MINTiMINT-253718.
STRINGi9606.ENSP00000271064.

Structurei

3D structure databases

ProteinModelPortaliQ9GZM7.
SMRiQ9GZM7. Positions 145-454.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini50 – 9849SMBPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the peptidase C1 family.PROSITE-ProRule annotation
Contains 1 SMB (somatomedin-B) domain.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG310046.
GeneTreeiENSGT00760000118871.
HOGENOMiHOG000241342.
HOVERGENiHBG053961.
InParanoidiQ9GZM7.
OMAiDNCNRCT.
OrthoDBiEOG7SV0V1.
PhylomeDBiQ9GZM7.
TreeFamiTF313765.

Family and domain databases

InterProiIPR025660. Pept_his_AS.
IPR013128. Peptidase_C1A.
IPR000668. Peptidase_C1A_C.
IPR001212. Somatomedin_B_dom.
[Graphical view]
PANTHERiPTHR12411. PTHR12411. 1 hit.
PfamiPF00112. Peptidase_C1. 1 hit.
[Graphical view]
SMARTiSM00645. Pept_C1. 1 hit.
SM00201. SO. 1 hit.
[Graphical view]
PROSITEiPS00524. SMB_1. 1 hit.
PS50958. SMB_2. 1 hit.
PS00639. THIOL_PROTEASE_HIS. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9GZM7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWRCPLGLLL LLPLAGHLAL GAQQGRGRRE LAPGLHLRGI RDAGGRYCQE
60 70 80 90 100
QDLCCRGRAD DCALPYLGAI CYCDLFCNRT VSDCCPDFWD FCLGVPPPFP
110 120 130 140 150
PIQGCMHGGR IYPVLGTYWD NCNRCTCQEN RQWQCDQEPC LVDPDMIKAI
160 170 180 190 200
NQGNYGWQAG NHSAFWGMTL DEGIRYRLGT IRPSSSVMNM HEIYTVLNPG
210 220 230 240 250
EVLPTAFEAS EKWPNLIHEP LDQGNCAGSW AFSTAAVASD RVSIHSLGHM
260 270 280 290 300
TPVLSPQNLL SCDTHQQQGC RGGRLDGAWW FLRRRGVVSD HCYPFSGRER
310 320 330 340 350
DEAGPAPPCM MHSRAMGRGK RQATAHCPNS YVNNNDIYQV TPVYRLGSND
360 370 380 390 400
KEIMKELMEN GPVQALMEVH EDFFLYKGGI YSHTPVSLGR PERYRRHGTH
410 420 430 440 450
SVKITGWGEE TLPDGRTLKY WTAANSWGPA WGERGHFRIV RGVNECDIES
460
FVLGVWGRVG MEDMGHH
Length:467
Mass (Da):52,387
Last modified:March 1, 2001 - v1
Checksum:iE9D72220E3E7B7D5
GO
Isoform 2 (identifier: Q9GZM7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-134: Missing.
     135-194: CDQEPCLVDP...SSVMNMHEIY → MVLGSSTQVK...EADRATFILQ
     286-286: G → GYAATGDVGREEGKELRGHGLGHDALSLSAFAPSCCLCR
     365-381: ALMEVHEDFFLYKGGIY → GKPPYPAPWFQKLVPA
     382-467: Missing.

Show »
Length:284
Mass (Da):30,845
Checksum:iE389D4425C84FB08
GO
Isoform 3 (identifier: Q9GZM7-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     126-156: Missing.

Note: No experimental confirmation available.

Show »
Length:436
Mass (Da):48,807
Checksum:iE66031AF51808DCD
GO

Sequence cautioni

The sequence AAH09048.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAB55403.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti333 – 3331N → Y in AAL55753. (PubMed:15498874)Curated
Sequence conflicti377 – 3771K → E in BAB55403. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti69 – 691A → S.
Corresponds to variant rs17497479 [ dbSNP | Ensembl ].
VAR_051514

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 134134Missing in isoform 2. 2 PublicationsVSP_013094Add
BLAST
Alternative sequencei126 – 15631Missing in isoform 3. 1 PublicationVSP_043712Add
BLAST
Alternative sequencei135 – 19460CDQEP…MHEIY → MVLGSSTQVKIGGSWNPAAA GGLKIKLQKALDLVALQCQW APEGQARAEQEADRATFILQ in isoform 2. 2 PublicationsVSP_013095Add
BLAST
Alternative sequencei286 – 2861G → GYAATGDVGREEGKELRGHG LGHDALSLSAFAPSCCLCR in isoform 2. 2 PublicationsVSP_013096
Alternative sequencei365 – 38117ALMEV…KGGIY → GKPPYPAPWFQKLVPA in isoform 2. 2 PublicationsVSP_013097Add
BLAST
Alternative sequencei382 – 46786Missing in isoform 2. 2 PublicationsVSP_013098Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF236155
, AF236151, AF236152, AF236153, AF236154 Genomic DNA. Translation: AAG40154.1.
AF236150 mRNA. Translation: AAG38876.1.
AF205436 mRNA. Translation: AAG33699.1.
AB050716 mRNA. Translation: BAB18636.1.
AB050719 Genomic DNA. Translation: BAB18727.1.
AK074124 mRNA. Translation: BAB84950.1.
AY358421 mRNA. Translation: AAQ88787.1.
AF289569 mRNA. Translation: AAL55753.1.
AK027839 mRNA. Translation: BAB55403.1. Different initiation.
AK292770 mRNA. Translation: BAF85459.1.
AK298382 mRNA. Translation: BAG60618.1.
AK075398 mRNA. Translation: BAC11596.1.
AC114488 Genomic DNA. No translation available.
CH471059 Genomic DNA. Translation: EAX07604.1.
CH471059 Genomic DNA. Translation: EAX07605.1.
CH471059 Genomic DNA. Translation: EAX07606.1.
BC009048 mRNA. Translation: AAH09048.1. Different initiation.
BC064633 mRNA. Translation: AAH64633.1.
CCDSiCCDS343.1. [Q9GZM7-1]
CCDS55586.1. [Q9GZM7-3]
RefSeqiNP_001191343.1. NM_001204414.1. [Q9GZM7-3]
NP_001191344.1. NM_001204415.1.
NP_071447.1. NM_022164.2. [Q9GZM7-1]
UniGeneiHs.199368.

Genome annotation databases

EnsembliENST00000271064; ENSP00000271064; ENSG00000142910. [Q9GZM7-1]
ENST00000457433; ENSP00000395137; ENSG00000142910. [Q9GZM7-3]
GeneIDi64129.
KEGGihsa:64129.
UCSCiuc001bta.3. human. [Q9GZM7-1]
uc010ogj.2. human. [Q9GZM7-3]

Polymorphism databases

DMDMi61213628.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF236155
, AF236151 , AF236152 , AF236153 , AF236154 Genomic DNA. Translation: AAG40154.1 .
AF236150 mRNA. Translation: AAG38876.1 .
AF205436 mRNA. Translation: AAG33699.1 .
AB050716 mRNA. Translation: BAB18636.1 .
AB050719 Genomic DNA. Translation: BAB18727.1 .
AK074124 mRNA. Translation: BAB84950.1 .
AY358421 mRNA. Translation: AAQ88787.1 .
AF289569 mRNA. Translation: AAL55753.1 .
AK027839 mRNA. Translation: BAB55403.1 . Different initiation.
AK292770 mRNA. Translation: BAF85459.1 .
AK298382 mRNA. Translation: BAG60618.1 .
AK075398 mRNA. Translation: BAC11596.1 .
AC114488 Genomic DNA. No translation available.
CH471059 Genomic DNA. Translation: EAX07604.1 .
CH471059 Genomic DNA. Translation: EAX07605.1 .
CH471059 Genomic DNA. Translation: EAX07606.1 .
BC009048 mRNA. Translation: AAH09048.1 . Different initiation.
BC064633 mRNA. Translation: AAH64633.1 .
CCDSi CCDS343.1. [Q9GZM7-1 ]
CCDS55586.1. [Q9GZM7-3 ]
RefSeqi NP_001191343.1. NM_001204414.1. [Q9GZM7-3 ]
NP_001191344.1. NM_001204415.1.
NP_071447.1. NM_022164.2. [Q9GZM7-1 ]
UniGenei Hs.199368.

3D structure databases

ProteinModelPortali Q9GZM7.
SMRi Q9GZM7. Positions 145-454.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122078. 15 interactions.
IntActi Q9GZM7. 52 interactions.
MINTi MINT-253718.
STRINGi 9606.ENSP00000271064.

Protein family/group databases

MEROPSi C01.975.

PTM databases

PhosphoSitei Q9GZM7.

Polymorphism databases

DMDMi 61213628.

Proteomic databases

MaxQBi Q9GZM7.
PaxDbi Q9GZM7.
PRIDEi Q9GZM7.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000271064 ; ENSP00000271064 ; ENSG00000142910 . [Q9GZM7-1 ]
ENST00000457433 ; ENSP00000395137 ; ENSG00000142910 . [Q9GZM7-3 ]
GeneIDi 64129.
KEGGi hsa:64129.
UCSCi uc001bta.3. human. [Q9GZM7-1 ]
uc010ogj.2. human. [Q9GZM7-3 ]

Organism-specific databases

CTDi 64129.
GeneCardsi GC01P032042.
HGNCi HGNC:19168. TINAGL1.
HPAi HPA048695.
neXtProti NX_Q9GZM7.
PharmGKBi PA38810.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG310046.
GeneTreei ENSGT00760000118871.
HOGENOMi HOG000241342.
HOVERGENi HBG053961.
InParanoidi Q9GZM7.
OMAi DNCNRCT.
OrthoDBi EOG7SV0V1.
PhylomeDBi Q9GZM7.
TreeFami TF313765.

Miscellaneous databases

ChiTaRSi TINAGL1. human.
GeneWikii TINAGL1.
GenomeRNAii 64129.
NextBioi 66016.
PROi Q9GZM7.

Gene expression databases

Bgeei Q9GZM7.
CleanExi HS_TINAGL1.
ExpressionAtlasi Q9GZM7. baseline and differential.
Genevestigatori Q9GZM7.

Family and domain databases

InterProi IPR025660. Pept_his_AS.
IPR013128. Peptidase_C1A.
IPR000668. Peptidase_C1A_C.
IPR001212. Somatomedin_B_dom.
[Graphical view ]
PANTHERi PTHR12411. PTHR12411. 1 hit.
Pfami PF00112. Peptidase_C1. 1 hit.
[Graphical view ]
SMARTi SM00645. Pept_C1. 1 hit.
SM00201. SO. 1 hit.
[Graphical view ]
PROSITEi PS00524. SMB_1. 1 hit.
PS50958. SMB_2. 1 hit.
PS00639. THIOL_PROTEASE_HIS. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning, characterization, and expression of the human TIN-ag-RP gene encoding a novel putative extracellular matrix protein."
    Broemme N.C., Wex T., Wex H., Levy B., Lipyansky A., Broemme D.
    Biochem. Biophys. Res. Commun. 271:474-480(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1), SUBCELLULAR LOCATION.
    Tissue: Muscle.
  2. "TIN-ag-RP, a novel catalytically inactive cathepsin B-related protein with EGF domains, is predominantly expressed in vascular smooth muscle cells."
    Wex T., Lipyansky A., Broemme N.C., Wex H., Guan X.Q., Broemme D.
    Biochemistry 40:1350-1357(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 22-27, TISSUE SPECIFICITY, GLYCOSYLATION, SUBCELLULAR LOCATION.
    Tissue: Muscle.
  3. "Identification of oxidized-LDL responsive gene 2 (OLRG-2), encoding a novel extracellular matrix protein in vascular endothelial cells."
    Zhang K.M., Chen B.S.
    Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  4. "Identification of a novel glucocorticoid-inducible cDNA partially homologous to tubulointerstitial nephritis antigen."
    Yoshida H., Takaishi K., Harada M., Nagasaka T., Tsurufuji S., Taniguchi M.
    Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1).
  5. "The nucleotide sequence of a long cDNA clone isolated from human spleen."
    Jikuya H., Takano J., Nomura N., Kikuno R., Nagase T., Ohara O.
    Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Placenta.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  7. "Large-scale cDNA transfection screening for genes related to cancer development and progression."
    Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.
    , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
    Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  8. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Kidney, Placenta and Trachea.
  9. "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries."
    Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.
    , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.
    DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Placenta.
  10. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  11. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  12. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Colon and Pancreas.
  13. "Signal peptide prediction based on analysis of experimentally verified cleavage sites."
    Zhang Z., Henzel W.J.
    Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 22-36.
  14. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
    Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
    J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-78 AND ASN-161.
    Tissue: Liver.

Entry informationi

Entry nameiTINAL_HUMAN
AccessioniPrimary (citable) accession number: Q9GZM7
Secondary accession number(s): A8K9Q5
, B4DPK6, D3DPN8, Q8TEJ9, Q8WZ23, Q96GZ4, Q96JW3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 15, 2005
Last sequence update: March 1, 2001
Last modified: November 26, 2014
This is version 115 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Peptidase families
    Classification of peptidase families and list of entries
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3