Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tubulointerstitial nephritis antigen-like

Gene

TINAGL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells. This is a non catalytic peptidase C1 family protein (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

  • cell adhesion Source: GO_Central
  • endosomal transport Source: UniProtKB
  • immune response Source: InterPro

Protein family/group databases

MEROPSiC01.975.

Names & Taxonomyi

Protein namesi
Recommended name:
Tubulointerstitial nephritis antigen-like
Alternative name(s):
Glucocorticoid-inducible protein 5
Oxidized LDL-responsive gene 2 protein
Short name:
OLRG-2
Tubulointerstitial nephritis antigen-related protein
Short name:
TIN Ag-related protein
Short name:
TIN-Ag-RP
Gene namesi
Name:TINAGL1
Synonyms:GIS5, LCN7, OLRG2, TINAGL
ORF Names:PP6614, PSEC0088, UNQ204/PRO230
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:19168. TINAGL1.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: Ensembl
  • extracellular exosome Source: UniProtKB
  • extracellular matrix Source: BHF-UCL
  • extracellular region Source: UniProtKB
  • extracellular space Source: BHF-UCL

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi64129.
OpenTargetsiENSG00000142910.
PharmGKBiPA38810.

Polymorphism and mutation databases

BioMutaiTINAGL1.
DMDMi61213628.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 212 PublicationsAdd BLAST21
ChainiPRO_000002648222 – 467Tubulointerstitial nephritis antigen-likeAdd BLAST446

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi54 ↔ 73AlternatePROSITE-ProRule annotation
Disulfide bondi71 ↔ 85AlternatePROSITE-ProRule annotation
Disulfide bondi71 ↔ 73AlternatePROSITE-ProRule annotation
Disulfide bondi77 ↔ 84PROSITE-ProRule annotation
Glycosylationi78N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi85 ↔ 92AlternatePROSITE-ProRule annotation
Glycosylationi161N-linked (GlcNAc...) asparagine1 Publication1

Post-translational modificationi

Glycosylated.2 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

EPDiQ9GZM7.
MaxQBiQ9GZM7.
PaxDbiQ9GZM7.
PeptideAtlasiQ9GZM7.
PRIDEiQ9GZM7.

Expressioni

Tissue specificityi

Highly expressed in aorta, heart, placenta, kidney and a colorectal adenocarcinoma cell line. Moderately expressed in skeletal muscle, pancreas, lung, lymph nodes, adrenal gland, bone marrow and thyroid. Weakly expressed in colon, small intestine, ovary, spleen, testis and prostate. Predominantly found in vascular smooth muscle cells, but also in cardiac and skeletal muscle cells as well as kidney.1 Publication

Gene expression databases

BgeeiENSG00000142910.
CleanExiHS_TINAGL1.
ExpressionAtlasiQ9GZM7. baseline and differential.
GenevisibleiQ9GZM7. HS.

Organism-specific databases

HPAiHPA048695.

Interactioni

Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

BioGridi122078. 21 interactors.
IntActiQ9GZM7. 60 interactors.
MINTiMINT-253718.
STRINGi9606.ENSP00000271064.

Structurei

3D structure databases

ProteinModelPortaliQ9GZM7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini50 – 98SMBPROSITE-ProRule annotationAdd BLAST49

Sequence similaritiesi

Belongs to the peptidase C1 family.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG1544. Eukaryota.
ENOG410YN9K. LUCA.
GeneTreeiENSGT00760000118871.
HOGENOMiHOG000241342.
HOVERGENiHBG053961.
InParanoidiQ9GZM7.
OMAiKYWIAAN.
OrthoDBiEOG091G0A2N.
PhylomeDBiQ9GZM7.
TreeFamiTF313765.

Family and domain databases

InterProiView protein in InterPro
IPR025660. Pept_his_AS.
IPR013128. Peptidase_C1A.
IPR000668. Peptidase_C1A_C.
IPR001212. Somatomedin_B_dom.
PANTHERiPTHR12411. PTHR12411. 1 hit.
PfamiView protein in Pfam
PF00112. Peptidase_C1. 1 hit.
SMARTiView protein in SMART
SM00645. Pept_C1. 1 hit.
PROSITEiView protein in PROSITE
PS00524. SMB_1. 1 hit.
PS50958. SMB_2. 1 hit.
PS00639. THIOL_PROTEASE_HIS. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9GZM7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWRCPLGLLL LLPLAGHLAL GAQQGRGRRE LAPGLHLRGI RDAGGRYCQE
60 70 80 90 100
QDLCCRGRAD DCALPYLGAI CYCDLFCNRT VSDCCPDFWD FCLGVPPPFP
110 120 130 140 150
PIQGCMHGGR IYPVLGTYWD NCNRCTCQEN RQWQCDQEPC LVDPDMIKAI
160 170 180 190 200
NQGNYGWQAG NHSAFWGMTL DEGIRYRLGT IRPSSSVMNM HEIYTVLNPG
210 220 230 240 250
EVLPTAFEAS EKWPNLIHEP LDQGNCAGSW AFSTAAVASD RVSIHSLGHM
260 270 280 290 300
TPVLSPQNLL SCDTHQQQGC RGGRLDGAWW FLRRRGVVSD HCYPFSGRER
310 320 330 340 350
DEAGPAPPCM MHSRAMGRGK RQATAHCPNS YVNNNDIYQV TPVYRLGSND
360 370 380 390 400
KEIMKELMEN GPVQALMEVH EDFFLYKGGI YSHTPVSLGR PERYRRHGTH
410 420 430 440 450
SVKITGWGEE TLPDGRTLKY WTAANSWGPA WGERGHFRIV RGVNECDIES
460
FVLGVWGRVG MEDMGHH
Length:467
Mass (Da):52,387
Last modified:March 1, 2001 - v1
Checksum:iE9D72220E3E7B7D5
GO
Isoform 2 (identifier: Q9GZM7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-134: Missing.
     135-194: CDQEPCLVDP...SSVMNMHEIY → MVLGSSTQVK...EADRATFILQ
     286-286: G → GYAATGDVGREEGKELRGHGLGHDALSLSAFAPSCCLCR
     365-381: ALMEVHEDFFLYKGGIY → GKPPYPAPWFQKLVPA
     382-467: Missing.

Show »
Length:284
Mass (Da):30,845
Checksum:iE389D4425C84FB08
GO
Isoform 3 (identifier: Q9GZM7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     126-156: Missing.

Note: No experimental confirmation available.
Show »
Length:436
Mass (Da):48,807
Checksum:iE66031AF51808DCD
GO

Sequence cautioni

The sequence AAH09048 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB55403 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti333N → Y in AAL55753 (PubMed:15498874).Curated1
Sequence conflicti377K → E in BAB55403 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05151469A → S. Corresponds to variant dbSNP:rs17497479Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0130941 – 134Missing in isoform 2. 2 PublicationsAdd BLAST134
Alternative sequenceiVSP_043712126 – 156Missing in isoform 3. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_013095135 – 194CDQEP…MHEIY → MVLGSSTQVKIGGSWNPAAA GGLKIKLQKALDLVALQCQW APEGQARAEQEADRATFILQ in isoform 2. 2 PublicationsAdd BLAST60
Alternative sequenceiVSP_013096286G → GYAATGDVGREEGKELRGHG LGHDALSLSAFAPSCCLCR in isoform 2. 2 Publications1
Alternative sequenceiVSP_013097365 – 381ALMEV…KGGIY → GKPPYPAPWFQKLVPA in isoform 2. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_013098382 – 467Missing in isoform 2. 2 PublicationsAdd BLAST86

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF236155
, AF236151, AF236152, AF236153, AF236154 Genomic DNA. Translation: AAG40154.1.
AF236150 mRNA. Translation: AAG38876.1.
AF205436 mRNA. Translation: AAG33699.1.
AB050716 mRNA. Translation: BAB18636.1.
AB050719 Genomic DNA. Translation: BAB18727.1.
AK074124 mRNA. Translation: BAB84950.1.
AY358421 mRNA. Translation: AAQ88787.1.
AF289569 mRNA. Translation: AAL55753.1.
AK027839 mRNA. Translation: BAB55403.1. Different initiation.
AK292770 mRNA. Translation: BAF85459.1.
AK298382 mRNA. Translation: BAG60618.1.
AK075398 mRNA. Translation: BAC11596.1.
AC114488 Genomic DNA. No translation available.
CH471059 Genomic DNA. Translation: EAX07604.1.
CH471059 Genomic DNA. Translation: EAX07605.1.
CH471059 Genomic DNA. Translation: EAX07606.1.
BC009048 mRNA. Translation: AAH09048.1. Different initiation.
BC064633 mRNA. Translation: AAH64633.1.
CCDSiCCDS343.1. [Q9GZM7-1]
CCDS55586.1. [Q9GZM7-3]
RefSeqiNP_001191343.1. NM_001204414.1. [Q9GZM7-3]
NP_001191344.1. NM_001204415.1.
NP_071447.1. NM_022164.2. [Q9GZM7-1]
UniGeneiHs.199368.

Genome annotation databases

EnsembliENST00000271064; ENSP00000271064; ENSG00000142910. [Q9GZM7-1]
ENST00000457433; ENSP00000395137; ENSG00000142910. [Q9GZM7-3]
GeneIDi64129.
KEGGihsa:64129.
UCSCiuc001bta.4. human. [Q9GZM7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.

Entry informationi

Entry nameiTINAL_HUMAN
AccessioniPrimary (citable) accession number: Q9GZM7
Secondary accession number(s): A8K9Q5
, B4DPK6, D3DPN8, Q8TEJ9, Q8WZ23, Q96GZ4, Q96JW3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 15, 2005
Last sequence update: March 1, 2001
Last modified: June 7, 2017
This is version 139 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Peptidase families
    Classification of peptidase families and list of entries
  6. SIMILARITY comments
    Index of protein domains and families