Q9GZM7 (TINAL_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 100.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tubulointerstitial nephritis antigen-like Alternative name(s): Glucocorticoid-inducible protein 5 Oxidized LDL-responsive gene 2 protein Short name=OLRG-2 Tubulointerstitial nephritis antigen-related protein Short name=TIN Ag-related protein Short name=TIN-Ag-RP | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 467 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells. This is a non catalytic peptidase C1 family protein By similarity. |
| Subcellular location | |
| Tissue specificity | Highly expressed in aorta, heart, placenta, kidney and a colorectal adenocarcinoma cell line. Moderately expressed in skeletal muscle, pancreas, lung, lymph nodes, adrenal gland, bone marrow and thyroid. Weakly expressed in colon, small intestine, ovary, spleen, testis and prostate. Predominantly found in vascular smooth muscle cells, but also in cardiac and skeletal muscle cells as well as kidney. Ref.2 |
| Post-translational modification | Glycosylated. Ref.2 |
| Sequence similarities | Belongs to the peptidase C1 family. Contains 1 SMB (somatomedin-B) domain. |
| Sequence caution | The sequence AAH09048.1 differs from that shown. Reason: Erroneous initiation. The sequence BAB55403.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9GZM7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9GZM7-2) The sequence of this isoform differs from the canonical sequence as follows: 1-134: Missing. 135-194: CDQEPCLVDP...SSVMNMHEIY → MVLGSSTQVK...EADRATFILQ 286-286: G → GYAATGDVGREEGKELRGHGLGHDALSLSAFAPSCCLCR 365-381: ALMEVHEDFFLYKGGIY → GKPPYPAPWFQKLVPA 382-467: Missing. | ||||||
| Isoform 3 (identifier: Q9GZM7-3) The sequence of this isoform differs from the canonical sequence as follows: 126-156: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 21 | 21 | Ref.2 Ref.13 | ||||||||
| Chain | 22 – 467 | 446 | Tubulointerstitial nephritis antigen-like | PRO_0000026482 | |||||||
Regions | |||||||||||
| Domain | 50 – 98 | 49 | SMB | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 78 | 1 | N-linked (GlcNAc...) Ref.14 | ||||||||
| Glycosylation | 161 | 1 | N-linked (GlcNAc...) Ref.14 | ||||||||
| Disulfide bond | 54 ↔ 73 | Alternate By similarity | |||||||||
| Disulfide bond | 71 ↔ 85 | Alternate By similarity | |||||||||
| Disulfide bond | 71 ↔ 73 | By similarity | |||||||||
| Disulfide bond | 77 ↔ 84 | By similarity | |||||||||
| Disulfide bond | 85 ↔ 92 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 134 | 134 | Missing in isoform 2. | VSP_013094 | |||||||
| Alternative sequence | 126 – 156 | 31 | Missing in isoform 3. | VSP_043712 | |||||||
| Alternative sequence | 135 – 194 | 60 | CDQEP…MHEIY → MVLGSSTQVKIGGSWNPAAA GGLKIKLQKALDLVALQCQW APEGQARAEQEADRATFILQ in isoform 2. | VSP_013095 | |||||||
| Alternative sequence | 286 | 1 | G → GYAATGDVGREEGKELRGHG LGHDALSLSAFAPSCCLCR in isoform 2. | VSP_013096 | |||||||
| Alternative sequence | 365 – 381 | 17 | ALMEV…KGGIY → GKPPYPAPWFQKLVPA in isoform 2. | VSP_013097 | |||||||
| Alternative sequence | 382 – 467 | 86 | Missing in isoform 2. | VSP_013098 | |||||||
| Natural variant | 69 | 1 | A → S. Corresponds to variant rs17497479 [ dbSNP | Ensembl ]. | VAR_051514 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 333 | 1 | N → Y in AAL55753. Ref.7 | ||||||||
| Sequence conflict | 377 | 1 | K → E in BAB55403. Ref.8 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning, characterization, and expression of the human TIN-ag-RP gene encoding a novel putative extracellular matrix protein." Broemme N.C., Wex T., Wex H., Levy B., Lipyansky A., Broemme D. Biochem. Biophys. Res. Commun. 271:474-480(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1), SUBCELLULAR LOCATION. Tissue: Muscle. |
| [2] | "TIN-ag-RP, a novel catalytically inactive cathepsin B-related protein with EGF domains, is predominantly expressed in vascular smooth muscle cells." Wex T., Lipyansky A., Broemme N.C., Wex H., Guan X.Q., Broemme D. Biochemistry 40:1350-1357(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 22-27, TISSUE SPECIFICITY, GLYCOSYLATION, SUBCELLULAR LOCATION. Tissue: Muscle. |
| [3] | "Identification of oxidized-LDL responsive gene 2 (OLRG-2), encoding a novel extracellular matrix protein in vascular endothelial cells." Zhang K.M., Chen B.S. Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Identification of a novel glucocorticoid-inducible cDNA partially homologous to tubulointerstitial nephritis antigen." Yoshida H., Takaishi K., Harada M., Nagasaka T., Tsurufuji S., Taniguchi M. Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1). |
| [5] | "The nucleotide sequence of a long cDNA clone isolated from human spleen." Jikuya H., Takano J., Nomura N., Kikuno R., Nagase T., Ohara O. Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Placenta. |
| [6] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [7] | "Large-scale cDNA transfection screening for genes related to cancer development and progression." Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X. Gu J.Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [8] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Kidney, Placenta and Trachea. |
| [9] | "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries." Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y. Isogai T.DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Placenta. |
| [10] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [11] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [12] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Colon and Pancreas. |
| [13] | "Signal peptide prediction based on analysis of experimentally verified cleavage sites." Zhang Z., Henzel W.J. Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 22-36. |
| [14] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-78 AND ASN-161, MASS SPECTROMETRY. Tissue: Liver. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF236155 AF236154 Genomic DNA. Translation: AAG40154.1.AF236150 mRNA. Translation: AAG38876.1. AF205436 mRNA. Translation: AAG33699.1. AB050716 mRNA. Translation: BAB18636.1. AB050719 Genomic DNA. Translation: BAB18727.1. AK074124 mRNA. Translation: BAB84950.1. AY358421 mRNA. Translation: AAQ88787.1. AF289569 mRNA. Translation: AAL55753.1. AK027839 mRNA. Translation: BAB55403.1. Different initiation. AK292770 mRNA. Translation: BAF85459.1. AK298382 mRNA. Translation: BAG60618.1. AK075398 mRNA. Translation: BAC11596.1. AC114488 Genomic DNA. No translation available. CH471059 Genomic DNA. Translation: EAX07604.1. CH471059 Genomic DNA. Translation: EAX07605.1. CH471059 Genomic DNA. Translation: EAX07606.1. BC009048 mRNA. Translation: AAH09048.1. Different initiation. BC064633 mRNA. Translation: AAH64633.1. |
| IPI | IPI00005563. IPI00439435. IPI00910801. |
| RefSeq | NP_001191343.1. NM_001204414.1. NP_001191344.1. NM_001204415.1. NP_071447.1. NM_022164.2. |
| UniGene | Hs.199368. |
3D structure databases | |
| ProteinModelPortal | Q9GZM7. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9GZM7. 50 interactions. |
| MINT | MINT-253718. |
| STRING | 9606.ENSP00000271064. |
Protein family/group databases | |
| MEROPS | C01.975. |
PTM databases | |
| PhosphoSite | Q9GZM7. |
Polymorphism databases | |
| DMDM | 61213628. |
Proteomic databases | |
| PaxDb | Q9GZM7. |
| PRIDE | Q9GZM7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000271064; ENSP00000271064; ENSG00000142910. ENST00000457433; ENSP00000395137; ENSG00000142910. |
| GeneID | 64129. |
| KEGG | hsa:64129. |
| UCSC | uc001bta.3. human. |
Organism-specific databases | |
| CTD | 64129. |
| GeneCards | GC01P032042. |
| HGNC | HGNC:19168. TINAGL1. |
| HPA | HPA048695. |
| neXtProt | NX_Q9GZM7. |
| PharmGKB | PA38810. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG310046. |
| HOGENOM | HOG000241342. |
| HOVERGEN | HBG053961. |
| InParanoid | Q9GZM7. |
| OMA | DNCNRCT. |
| OrthoDB | EOG4BG8W0. |
| PhylomeDB | Q9GZM7. |
Gene expression databases | |
| ArrayExpress | Q9GZM7. |
| Bgee | Q9GZM7. |
| CleanEx | HS_TINAGL1. |
| Genevestigator | Q9GZM7. |
| GermOnline | ENSG00000142910. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR025660. Pept_his_AS. IPR013128. Peptidase_C1A. IPR000668. Peptidase_C1A_C. IPR001212. Somatomedin_B_dom. [Graphical view] |
| PANTHER | PTHR12411. PTHR12411. 1 hit. |
| Pfam | PF00112. Peptidase_C1. 1 hit. [Graphical view] |
| SMART | SM00645. Pept_C1. 1 hit. SM00201. SO. 1 hit. [Graphical view] |
| PROSITE | PS00524. SMB_1. 1 hit. PS50958. SMB_2. 1 hit. PS00639. THIOL_PROTEASE_HIS. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | TINAGL1. human. |
| GenomeRNAi | 64129. |
| NextBio | 66016. |
Entry information
| Entry name | TINAL_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9GZM7 Secondary accession number(s): A8K9Q5 Q96JW3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
