Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9GZM7

- TINAL_HUMAN

UniProt

Q9GZM7 - TINAL_HUMAN

Protein

Tubulointerstitial nephritis antigen-like

Gene

TINAGL1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 113 (01 Oct 2014)
      Sequence version 1 (01 Mar 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells. This is a non catalytic peptidase C1 family protein By similarity.By similarity

    GO - Molecular functioni

    1. cysteine-type peptidase activity Source: InterPro
    2. extracellular matrix structural constituent Source: UniProtKB
    3. polysaccharide binding Source: InterPro
    4. scavenger receptor activity Source: InterPro

    GO - Biological processi

    1. endosomal transport Source: UniProtKB
    2. immune response Source: InterPro

    Protein family/group databases

    MEROPSiC01.975.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Tubulointerstitial nephritis antigen-like
    Alternative name(s):
    Glucocorticoid-inducible protein 5
    Oxidized LDL-responsive gene 2 protein
    Short name:
    OLRG-2
    Tubulointerstitial nephritis antigen-related protein
    Short name:
    TIN Ag-related protein
    Short name:
    TIN-Ag-RP
    Gene namesi
    Name:TINAGL1
    Synonyms:GIS5, LCN7, OLRG2, TINAGL
    ORF Names:PP6614, PSEC0088, UNQ204/PRO230
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:19168. TINAGL1.

    Subcellular locationi

    Secreted 2 Publications

    GO - Cellular componenti

    1. cytoplasm Source: Ensembl
    2. extracellular region Source: UniProtKB
    3. extracellular space Source: BHF-UCL
    4. extracellular vesicular exosome Source: UniProt

    Keywords - Cellular componenti

    Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA38810.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 21212 PublicationsAdd
    BLAST
    Chaini22 – 467446Tubulointerstitial nephritis antigen-likePRO_0000026482Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi54 ↔ 73AlternatePROSITE-ProRule annotation
    Disulfide bondi71 ↔ 85AlternatePROSITE-ProRule annotation
    Disulfide bondi71 ↔ 73AlternatePROSITE-ProRule annotation
    Disulfide bondi77 ↔ 84PROSITE-ProRule annotation
    Glycosylationi78 – 781N-linked (GlcNAc...)2 Publications
    Disulfide bondi85 ↔ 92AlternatePROSITE-ProRule annotation
    Glycosylationi161 – 1611N-linked (GlcNAc...)2 Publications

    Post-translational modificationi

    Glycosylated.2 Publications

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    MaxQBiQ9GZM7.
    PaxDbiQ9GZM7.
    PRIDEiQ9GZM7.

    PTM databases

    PhosphoSiteiQ9GZM7.

    Expressioni

    Tissue specificityi

    Highly expressed in aorta, heart, placenta, kidney and a colorectal adenocarcinoma cell line. Moderately expressed in skeletal muscle, pancreas, lung, lymph nodes, adrenal gland, bone marrow and thyroid. Weakly expressed in colon, small intestine, ovary, spleen, testis and prostate. Predominantly found in vascular smooth muscle cells, but also in cardiac and skeletal muscle cells as well as kidney.1 Publication

    Gene expression databases

    ArrayExpressiQ9GZM7.
    BgeeiQ9GZM7.
    CleanExiHS_TINAGL1.
    GenevestigatoriQ9GZM7.

    Organism-specific databases

    HPAiHPA048695.

    Interactioni

    Protein-protein interaction databases

    BioGridi122078. 9 interactions.
    IntActiQ9GZM7. 52 interactions.
    MINTiMINT-253718.
    STRINGi9606.ENSP00000271064.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9GZM7.
    SMRiQ9GZM7. Positions 145-454.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini50 – 9849SMBPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the peptidase C1 family.PROSITE-ProRule annotation
    Contains 1 SMB (somatomedin-B) domain.Curated

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG310046.
    HOGENOMiHOG000241342.
    HOVERGENiHBG053961.
    InParanoidiQ9GZM7.
    OMAiDNCNRCT.
    OrthoDBiEOG7SV0V1.
    PhylomeDBiQ9GZM7.
    TreeFamiTF313765.

    Family and domain databases

    InterProiIPR025660. Pept_his_AS.
    IPR013128. Peptidase_C1A.
    IPR000668. Peptidase_C1A_C.
    IPR001212. Somatomedin_B_dom.
    [Graphical view]
    PANTHERiPTHR12411. PTHR12411. 1 hit.
    PfamiPF00112. Peptidase_C1. 1 hit.
    [Graphical view]
    SMARTiSM00645. Pept_C1. 1 hit.
    SM00201. SO. 1 hit.
    [Graphical view]
    PROSITEiPS00524. SMB_1. 1 hit.
    PS50958. SMB_2. 1 hit.
    PS00639. THIOL_PROTEASE_HIS. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9GZM7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MWRCPLGLLL LLPLAGHLAL GAQQGRGRRE LAPGLHLRGI RDAGGRYCQE    50
    QDLCCRGRAD DCALPYLGAI CYCDLFCNRT VSDCCPDFWD FCLGVPPPFP 100
    PIQGCMHGGR IYPVLGTYWD NCNRCTCQEN RQWQCDQEPC LVDPDMIKAI 150
    NQGNYGWQAG NHSAFWGMTL DEGIRYRLGT IRPSSSVMNM HEIYTVLNPG 200
    EVLPTAFEAS EKWPNLIHEP LDQGNCAGSW AFSTAAVASD RVSIHSLGHM 250
    TPVLSPQNLL SCDTHQQQGC RGGRLDGAWW FLRRRGVVSD HCYPFSGRER 300
    DEAGPAPPCM MHSRAMGRGK RQATAHCPNS YVNNNDIYQV TPVYRLGSND 350
    KEIMKELMEN GPVQALMEVH EDFFLYKGGI YSHTPVSLGR PERYRRHGTH 400
    SVKITGWGEE TLPDGRTLKY WTAANSWGPA WGERGHFRIV RGVNECDIES 450
    FVLGVWGRVG MEDMGHH 467
    Length:467
    Mass (Da):52,387
    Last modified:March 1, 2001 - v1
    Checksum:iE9D72220E3E7B7D5
    GO
    Isoform 2 (identifier: Q9GZM7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-134: Missing.
         135-194: CDQEPCLVDP...SSVMNMHEIY → MVLGSSTQVK...EADRATFILQ
         286-286: G → GYAATGDVGREEGKELRGHGLGHDALSLSAFAPSCCLCR
         365-381: ALMEVHEDFFLYKGGIY → GKPPYPAPWFQKLVPA
         382-467: Missing.

    Show »
    Length:284
    Mass (Da):30,845
    Checksum:iE389D4425C84FB08
    GO
    Isoform 3 (identifier: Q9GZM7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         126-156: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:436
    Mass (Da):48,807
    Checksum:iE66031AF51808DCD
    GO

    Sequence cautioni

    The sequence AAH09048.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAB55403.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti333 – 3331N → Y in AAL55753. (PubMed:15498874)Curated
    Sequence conflicti377 – 3771K → E in BAB55403. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti69 – 691A → S.
    Corresponds to variant rs17497479 [ dbSNP | Ensembl ].
    VAR_051514

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 134134Missing in isoform 2. 2 PublicationsVSP_013094Add
    BLAST
    Alternative sequencei126 – 15631Missing in isoform 3. 1 PublicationVSP_043712Add
    BLAST
    Alternative sequencei135 – 19460CDQEP…MHEIY → MVLGSSTQVKIGGSWNPAAA GGLKIKLQKALDLVALQCQW APEGQARAEQEADRATFILQ in isoform 2. 2 PublicationsVSP_013095Add
    BLAST
    Alternative sequencei286 – 2861G → GYAATGDVGREEGKELRGHG LGHDALSLSAFAPSCCLCR in isoform 2. 2 PublicationsVSP_013096
    Alternative sequencei365 – 38117ALMEV…KGGIY → GKPPYPAPWFQKLVPA in isoform 2. 2 PublicationsVSP_013097Add
    BLAST
    Alternative sequencei382 – 46786Missing in isoform 2. 2 PublicationsVSP_013098Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF236155
    , AF236151, AF236152, AF236153, AF236154 Genomic DNA. Translation: AAG40154.1.
    AF236150 mRNA. Translation: AAG38876.1.
    AF205436 mRNA. Translation: AAG33699.1.
    AB050716 mRNA. Translation: BAB18636.1.
    AB050719 Genomic DNA. Translation: BAB18727.1.
    AK074124 mRNA. Translation: BAB84950.1.
    AY358421 mRNA. Translation: AAQ88787.1.
    AF289569 mRNA. Translation: AAL55753.1.
    AK027839 mRNA. Translation: BAB55403.1. Different initiation.
    AK292770 mRNA. Translation: BAF85459.1.
    AK298382 mRNA. Translation: BAG60618.1.
    AK075398 mRNA. Translation: BAC11596.1.
    AC114488 Genomic DNA. No translation available.
    CH471059 Genomic DNA. Translation: EAX07604.1.
    CH471059 Genomic DNA. Translation: EAX07605.1.
    CH471059 Genomic DNA. Translation: EAX07606.1.
    BC009048 mRNA. Translation: AAH09048.1. Different initiation.
    BC064633 mRNA. Translation: AAH64633.1.
    CCDSiCCDS343.1. [Q9GZM7-1]
    CCDS55586.1. [Q9GZM7-3]
    RefSeqiNP_001191343.1. NM_001204414.1. [Q9GZM7-3]
    NP_001191344.1. NM_001204415.1.
    NP_071447.1. NM_022164.2. [Q9GZM7-1]
    UniGeneiHs.199368.

    Genome annotation databases

    EnsembliENST00000271064; ENSP00000271064; ENSG00000142910. [Q9GZM7-1]
    ENST00000457433; ENSP00000395137; ENSG00000142910. [Q9GZM7-3]
    GeneIDi64129.
    KEGGihsa:64129.
    UCSCiuc001bta.3. human. [Q9GZM7-1]
    uc010ogj.2. human. [Q9GZM7-3]

    Polymorphism databases

    DMDMi61213628.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF236155
    , AF236151 , AF236152 , AF236153 , AF236154 Genomic DNA. Translation: AAG40154.1 .
    AF236150 mRNA. Translation: AAG38876.1 .
    AF205436 mRNA. Translation: AAG33699.1 .
    AB050716 mRNA. Translation: BAB18636.1 .
    AB050719 Genomic DNA. Translation: BAB18727.1 .
    AK074124 mRNA. Translation: BAB84950.1 .
    AY358421 mRNA. Translation: AAQ88787.1 .
    AF289569 mRNA. Translation: AAL55753.1 .
    AK027839 mRNA. Translation: BAB55403.1 . Different initiation.
    AK292770 mRNA. Translation: BAF85459.1 .
    AK298382 mRNA. Translation: BAG60618.1 .
    AK075398 mRNA. Translation: BAC11596.1 .
    AC114488 Genomic DNA. No translation available.
    CH471059 Genomic DNA. Translation: EAX07604.1 .
    CH471059 Genomic DNA. Translation: EAX07605.1 .
    CH471059 Genomic DNA. Translation: EAX07606.1 .
    BC009048 mRNA. Translation: AAH09048.1 . Different initiation.
    BC064633 mRNA. Translation: AAH64633.1 .
    CCDSi CCDS343.1. [Q9GZM7-1 ]
    CCDS55586.1. [Q9GZM7-3 ]
    RefSeqi NP_001191343.1. NM_001204414.1. [Q9GZM7-3 ]
    NP_001191344.1. NM_001204415.1.
    NP_071447.1. NM_022164.2. [Q9GZM7-1 ]
    UniGenei Hs.199368.

    3D structure databases

    ProteinModelPortali Q9GZM7.
    SMRi Q9GZM7. Positions 145-454.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122078. 9 interactions.
    IntActi Q9GZM7. 52 interactions.
    MINTi MINT-253718.
    STRINGi 9606.ENSP00000271064.

    Protein family/group databases

    MEROPSi C01.975.

    PTM databases

    PhosphoSitei Q9GZM7.

    Polymorphism databases

    DMDMi 61213628.

    Proteomic databases

    MaxQBi Q9GZM7.
    PaxDbi Q9GZM7.
    PRIDEi Q9GZM7.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000271064 ; ENSP00000271064 ; ENSG00000142910 . [Q9GZM7-1 ]
    ENST00000457433 ; ENSP00000395137 ; ENSG00000142910 . [Q9GZM7-3 ]
    GeneIDi 64129.
    KEGGi hsa:64129.
    UCSCi uc001bta.3. human. [Q9GZM7-1 ]
    uc010ogj.2. human. [Q9GZM7-3 ]

    Organism-specific databases

    CTDi 64129.
    GeneCardsi GC01P032042.
    HGNCi HGNC:19168. TINAGL1.
    HPAi HPA048695.
    neXtProti NX_Q9GZM7.
    PharmGKBi PA38810.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG310046.
    HOGENOMi HOG000241342.
    HOVERGENi HBG053961.
    InParanoidi Q9GZM7.
    OMAi DNCNRCT.
    OrthoDBi EOG7SV0V1.
    PhylomeDBi Q9GZM7.
    TreeFami TF313765.

    Miscellaneous databases

    ChiTaRSi TINAGL1. human.
    GeneWikii TINAGL1.
    GenomeRNAii 64129.
    NextBioi 66016.
    PROi Q9GZM7.

    Gene expression databases

    ArrayExpressi Q9GZM7.
    Bgeei Q9GZM7.
    CleanExi HS_TINAGL1.
    Genevestigatori Q9GZM7.

    Family and domain databases

    InterProi IPR025660. Pept_his_AS.
    IPR013128. Peptidase_C1A.
    IPR000668. Peptidase_C1A_C.
    IPR001212. Somatomedin_B_dom.
    [Graphical view ]
    PANTHERi PTHR12411. PTHR12411. 1 hit.
    Pfami PF00112. Peptidase_C1. 1 hit.
    [Graphical view ]
    SMARTi SM00645. Pept_C1. 1 hit.
    SM00201. SO. 1 hit.
    [Graphical view ]
    PROSITEi PS00524. SMB_1. 1 hit.
    PS50958. SMB_2. 1 hit.
    PS00639. THIOL_PROTEASE_HIS. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning, characterization, and expression of the human TIN-ag-RP gene encoding a novel putative extracellular matrix protein."
      Broemme N.C., Wex T., Wex H., Levy B., Lipyansky A., Broemme D.
      Biochem. Biophys. Res. Commun. 271:474-480(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1), SUBCELLULAR LOCATION.
      Tissue: Muscle.
    2. "TIN-ag-RP, a novel catalytically inactive cathepsin B-related protein with EGF domains, is predominantly expressed in vascular smooth muscle cells."
      Wex T., Lipyansky A., Broemme N.C., Wex H., Guan X.Q., Broemme D.
      Biochemistry 40:1350-1357(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 22-27, TISSUE SPECIFICITY, GLYCOSYLATION, SUBCELLULAR LOCATION.
      Tissue: Muscle.
    3. "Identification of oxidized-LDL responsive gene 2 (OLRG-2), encoding a novel extracellular matrix protein in vascular endothelial cells."
      Zhang K.M., Chen B.S.
      Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    4. "Identification of a novel glucocorticoid-inducible cDNA partially homologous to tubulointerstitial nephritis antigen."
      Yoshida H., Takaishi K., Harada M., Nagasaka T., Tsurufuji S., Taniguchi M.
      Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1).
    5. "The nucleotide sequence of a long cDNA clone isolated from human spleen."
      Jikuya H., Takano J., Nomura N., Kikuno R., Nagase T., Ohara O.
      Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Placenta.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    7. "Large-scale cDNA transfection screening for genes related to cancer development and progression."
      Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.
      , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
      Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    8. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Tissue: Kidney, Placenta and Trachea.
    9. "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries."
      Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.
      , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.
      DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Placenta.
    10. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    11. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    12. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Colon and Pancreas.
    13. "Signal peptide prediction based on analysis of experimentally verified cleavage sites."
      Zhang Z., Henzel W.J.
      Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 22-36.
    14. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
      Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
      J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-78 AND ASN-161.
      Tissue: Liver.

    Entry informationi

    Entry nameiTINAL_HUMAN
    AccessioniPrimary (citable) accession number: Q9GZM7
    Secondary accession number(s): A8K9Q5
    , B4DPK6, D3DPN8, Q8TEJ9, Q8WZ23, Q96GZ4, Q96JW3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 15, 2005
    Last sequence update: March 1, 2001
    Last modified: October 1, 2014
    This is version 113 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. Peptidase families
      Classification of peptidase families and list of entries
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3