Reviewed,
UniProtKB/Swiss-Prot Q9GQF1 (JIP3_DROME)
Last modified
June 16, 2009.
Version 65.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: JNK-interacting protein 3 Alternative name(s): Protein sunday driver | ||||
| Gene names |
| ||||
| Organism | Drosophila melanogaster (Fruit fly) [Complete proteome] | ||||
| Taxonomic identifier | 7227 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora |
Protein attributes
| Sequence length | 1227 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | The JNK-interacting protein (JIP) group of scaffold proteins selectively mediates JNK-signaling by aggregating specific components of the MAPK cascade to form a functional JNK signaling module. May function as a regulator of vesicle transport, through interations with the JNK-signaling components and motor proteins. Syd is required for efficient kinesin-I mediated axonal transport. UniProtKB Q9ESN9 Ref.1 |
| Subunit structure | Forms homo- and heterooligomeric complexes. Binds the TPR motif-containing C-terminal of kinesin light chain, Klc. Pre-assembled syd scaffolding complexes are then transported as a cargo of kinesin, to the required subcellular location. |
| Subcellular location | Cytoplasm By similarity. UniProtKB Q9ESN9 |
| Sequence similarities | Belongs to the JIP scaffold family. |
| RNA editing | Edited at position 983. |
| Sequence caution | The sequence AAN71473.1 differs from that shown. Reason: Erroneous termination at position 795. Translated as Arg. The sequence AAN71473.1 differs from that shown. Reason: Frameshift at position 1207. The sequence AAV36895.1 differs from that shown. Reason: Frameshift at position 397. The sequence AAV36895.1 differs from that shown. Reason: Miscellaneous discrepancy. Intron retention. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing RNA editing |
| Domain | Coiled coil |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | axon cargo transport Ref.1 Inferred from mutant phenotype. Source: FlyBase regulation of JNK cascadeInferred from sequence or structural similarity. Source: UniProtKB vesicle-mediated transport Ref.1Inferred from expression pattern. Source: UniProtKB |
| Cellular component | Golgi membrane Inferred from sequence or structural similarity. Source: UniProtKB trans-Golgi network transport vesicle Ref.1Inferred from direct assay. Source: FlyBase |
| Molecular function | MAP-kinase scaffold activity Inferred from sequence or structural similarity. Source: UniProtKB kinesin binding Ref.1Inferred from physical interaction. Source: UniProtKB protein kinase bindingInferred from sequence or structural similarity. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: Q9GQF1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: Q9GQF1-2) The sequence of this isoform differs from the canonical sequence as follows: 1-34: MMDNDDALLNNGGPQSGAETVYGTEDNNMVMSEK → M | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1227 | 1227 | JNK-interacting protein 3 | PRO_0000220636 | |||||
Regions | |||||||||
| Coiled coil | 84 – 191 | 108 | Potential | ||||||
| Coiled coil | 363 – 489 | 127 | Potential | ||||||
| Coiled coil | 814 – 849 | 36 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 34 | 34 | MMDND…VMSEK → M in isoform B. | VSP_002780 | |||||
| Natural variant | 983 | 1 | S → G in RNA edited version. | ||||||
Experimental info | |||||||||
| Sequence conflict | 355 – 360 | 6 | Missing in AAN71473. Ref.4 | ||||||
| Sequence conflict | 792 | 1 | M → I in AAN71473. Ref.4 | ||||||
| Sequence conflict | 1124 | 1 | K → R in AAN71473. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Kinesin-dependent axonal transport is mediated by the Sunday Driver (SYD) protein." Bowman A.B., Kamal A., Ritchings B.W., Philp A.V., McGrail M., Gindhart J.G., Goldstein L.S.B. Cell 103:583-594(2000) [PubMed: 11106729] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), INTERACTION WITH KLC. |
| [2] | "The genome sequence of Drosophila melanogaster." Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. Venter J.C.Science 287:2185-2195(2000) [PubMed: 10731132] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Berkeley. |
| [3] | "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review." Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. Lewis S.E.Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed: 12537572] [Abstract] Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING. |
| [4] | "A Drosophila full-length cDNA resource." Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M., George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H., Rubin G.M., Celniker S.E. Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002) [PubMed: 12537569] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 937-1227. Strain: Berkeley. Tissue: Embryo and Head. |
| [5] | Stapleton M., Carlson J.W., Chavez C., Frise E., George R.A., Pacleb J.M., Park S., Wan K.H., Yu C., Rubin G.M., Celniker S.E. Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A). Strain: Berkeley. Tissue: Embryo. |
| [6] | "RNA editing in Drosophila melanogaster: new targets and functional consequences." Stapleton M., Carlson J.W., Celniker S.E. RNA 12:1922-1932(2006) [PubMed: 17018572] [Abstract] Cited for: RNA EDITING OF POSITION 983. |
Cross-references
Sequence databases | |
|---|---|
| AF262045 mRNA. Translation: AAG36930.1. AE014296 Genomic DNA. Translation: AAF50505.2. AE014296 Genomic DNA. Translation: AAN12032.2. AY060748 mRNA. Translation: AAL28296.1. Different initiation. BT001718 mRNA. Translation: AAN71473.1. Sequence problems. BT016010 mRNA. Translation: AAV36895.1. Sequence problems. | |
| RefSeq | NP_524652.1. NP_729311.2. |
| UniGene | Dm.6648 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9GQF1. 1 interaction. |
Proteomic databases | |
| PRIDE | Q9GQF1. |
Genome annotation databases | |
| Ensembl | FBgn0024187. Drosophila melanogaster. [Contig view] |
| GeneID | 43905. |
| KEGG | dme:Dmel_CG8110. |
Organism-specific databases | |
| FlyBase | FBgn0024187. syd. |
Phylogenomic databases | |
| HOGENOM | Q9GQF1. |
| OMA | Q9GQF1. VKTLMPL. |
Enzyme and pathway databases | |
| BioCyc | DMEL-XXX-02:DMEL-XXX-02-015659-MON. |
Gene expression databases | |
| ArrayExpress | Q9GQF1. |
| GermOnline | CG8110. Drosophila melanogaster. |
Family and domain databases | |
| InterPro | IPR019143. JNK/Rab-associated_protein-1. [Graphical view] |
| Pfam | PF09744. Jnk-SapK_ap_N. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 836329. |
Entry information
| Entry name | JIP3_DROME | ||||||||
| Accession | Primary (citable) accession number: Q9GQF1 Secondary accession number(s): Q5U182 Q9VSC0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| SIMILARITY comments Index of protein domains and families |

Clusters with


