Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Inorganic pyrophosphatase 2

Gene

At1g17710

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Catalyzes the specific cleavage of pyrophosphate.By similarity

Catalytic activityi

Diphosphate + H2O = 2 phosphate.

Cofactori

Mg2+By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei12NucleophileBy similarity1
Metal bindingi12MagnesiumBy similarity1
Active sitei14Proton donorBy similarity1
Metal bindingi14MagnesiumBy similarity1
Binding sitei23SubstrateBy similarity1
Binding sitei98SubstrateBy similarity1
Metal bindingi182MagnesiumBy similarity1

GO - Molecular functioni

  • inorganic diphosphatase activity Source: UniProtKB
  • metal ion binding Source: UniProtKB-KW
  • phosphocholine phosphatase activity Source: TAIR
  • phosphoethanolamine phosphatase activity Source: TAIR

GO - Biological processi

Keywordsi

Molecular functionHydrolase
LigandMagnesium, Metal-binding

Enzyme and pathway databases

BioCyciARA:AT1G17710-MONOMER.
BRENDAi3.1.3.75. 399.
ReactomeiR-ATH-1483191. Synthesis of PC.
R-ATH-1483213. Synthesis of PE.

Names & Taxonomyi

Protein namesi
Recommended name:
Inorganic pyrophosphatase 2 (EC:3.6.1.1)
Short name:
AtPPsPase2
Short name:
PPi phosphatase 2
Short name:
Pyrophosphate-specific phosphatase 2
Gene namesi
Ordered Locus Names:At1g17710
ORF Names:F11A6.5
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 1

Organism-specific databases

AraportiAT1G17710.
TAIRilocus:2007958. AT1G17710.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00004042571 – 279Inorganic pyrophosphatase 2Add BLAST279

Proteomic databases

PaxDbiQ9FZ62.
PRIDEiQ9FZ62.

Expressioni

Gene expression databases

GenevisibleiQ9FZ62. AT.

Interactioni

Subunit structurei

Tetramer.By similarity

Protein-protein interaction databases

STRINGi3702.AT1G17710.1.

Structurei

3D structure databases

ProteinModelPortaliQ9FZ62.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the HAD-like hydrolase superfamily.Curated

Phylogenomic databases

eggNOGiKOG3120. Eukaryota.
ENOG4111NAQ. LUCA.
HOGENOMiHOG000238030.
InParanoidiQ9FZ62.
KOiK13248.
OMAiYVGDSCN.
OrthoDBiEOG09360K2I.
PhylomeDBiQ9FZ62.

Family and domain databases

Gene3Di3.40.50.1000. 1 hit.
InterProiView protein in InterPro
IPR023214. HAD-like_dom.
IPR016965. Pase_PHOSPHO-typ.
IPR006384. PyrdxlP_Pase-rel.
PANTHERiPTHR20889. PTHR20889. 1 hit.
PfamiView protein in Pfam
PF06888. Put_Phosphatase. 1 hit.
PIRSFiPIRSF031051. PyrdxlP_Pase_PHOSPHO2. 1 hit.
SUPFAMiSSF56784. SSF56784. 1 hit.
TIGRFAMsiTIGR01489. DKMTPPase-SF. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9FZ62-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAKNNNIVIV FDFDKTIIDV DSDNWVVDEL GFTDLFNQLL PTMPWNSLMN
60 70 80 90 100
RMMKELHDHG KTIEEIKQVL RRIPIHPRVI PAIKSAHALG CELRIVSDAN
110 120 130 140 150
TLFIETIIEH LGIGEFFSEI NTNPGLVDEQ GRLIVSPYHD FTKSSHGCSR
160 170 180 190 200
CPPNMCKGLI IDRIQASLTK EGKTSKMIYL GDGAGDYCPS LGLKAEDYMM
210 220 230 240 250
PRKNFPVWDL ISQNPMLVKA TVRDWTDGED MERILMEIIN EIMSSEEGEE
260 270
NDKMLSSENC KISVGIVHEP IQVPLNLVK
Length:279
Mass (Da):31,570
Last modified:March 1, 2001 - v1
Checksum:i7AE316D0DAF7E0EE
GO
Isoform 2 (identifier: Q9FZ62-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-49: AKNNNIVIVFDFDKTIIDVDSDNWVVDELGFTDLFNQLLPTMPWNSLM → FISHNTKSLFGFISKQ

Note: Derived from EST data. No experimental confirmation available.
Show »
Length:247
Mass (Da):27,865
Checksum:i986F3A5D7979F278
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0405492 – 49AKNNN…WNSLM → FISHNTKSLFGFISKQ in isoform 2. CuratedAdd BLAST48

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC034257 Genomic DNA. Translation: AAF99814.1.
CP002684 Genomic DNA. Translation: AEE29624.1.
CP002684 Genomic DNA. Translation: AEE29625.1.
BT015372 mRNA. Translation: AAU05495.1.
BT015670 mRNA. Translation: AAU15169.1.
PIRiA86312.
RefSeqiNP_001077556.1. NM_001084087.1. [Q9FZ62-2]
NP_173213.2. NM_101633.4. [Q9FZ62-1]
UniGeneiAt.49892.

Genome annotation databases

EnsemblPlantsiAT1G17710.1; AT1G17710.1; AT1G17710. [Q9FZ62-1]
AT1G17710.2; AT1G17710.2; AT1G17710. [Q9FZ62-2]
GeneIDi838347.
GrameneiAT1G17710.1; AT1G17710.1; AT1G17710.
AT1G17710.2; AT1G17710.2; AT1G17710.
KEGGiath:AT1G17710.

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPPSP2_ARATH
AccessioniPrimary (citable) accession number: Q9FZ62
Secondary accession number(s): A8MQ90
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 8, 2011
Last sequence update: March 1, 2001
Last modified: August 30, 2017
This is version 102 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families