Q9FZ42 (GRDH1_ARATH) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 71.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Glucose and ribitol dehydrogenase homolog 1 EC=1.1.1.- | ||||
| Gene names |
| ||||
| Organism | Arabidopsis thaliana (Mouse-ear cress) [Reference proteome] | ||||
| Taxonomic identifier | 3702 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › eudicotyledons › core eudicotyledons › rosids › malvids › Brassicales › Brassicaceae › Camelineae › Arabidopsis![]() |
Protein attributes
| Sequence length | 288 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May act as a short alcohol-polyol-sugar dehydrogenase possibly related to carbohydrate metabolism and the acquisition of desiccation tolerance. May also be involved in signal transduction By similarity. |
| Sequence similarities | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative initiation |
| Molecular function | Oxidoreductase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | chloroplast Inferred from direct assay PubMed 21169366. Source: TAIR |
| Molecular_function | alcohol dehydrogenase (NADP+) activity Inferred from direct assay PubMed 21169366. Source: TAIR nucleotide bindingInferred from electronic annotation. Source: InterPro oxidoreductase activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative initiation. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9FZ42-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9FZ42-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MNVLCRVFTSSRVLSSNVTFSFSQIPNNTKKPLLEKRRLSPRVCLRAM | ||||||
| Note: Derived from EST data. No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 288 | 288 | Glucose and ribitol dehydrogenase homolog 1 | PRO_0000239257 | |||||
Regions | |||||||||
| Nucleotide binding | 41 – 65 | 25 | NAD or NADP By similarity | ||||||
Sites | |||||||||
| Active site | 192 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 179 | 1 | Substrate By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MNVLCRVFTSSRVLSSNVTF SFSQIPNNTKKPLLEKRRLS PRVCLRAM in isoform 2. | VSP_041301 | |||||
Experimental info | |||||||||
| Sequence conflict | 37 – 38 | 2 | Missing in AAG51119. Ref.1 | ||||||
| Sequence conflict | 193 | 1 | T → A in CAA81564. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AC064840 Genomic DNA. Translation: AAG00870.1. AC069144 Genomic DNA. Translation: AAG51119.1. CP002684 Genomic DNA. Translation: AEE33158.1. AF372931 mRNA. Translation: AAK50071.1. AY124852 mRNA. Translation: AAM70561.1. Z27012 mRNA. Translation: CAA81564.1. |
| IPI | IPI00530438. IPI01018443. |
| PIR | C96590. |
| RefSeq | NP_564670.2. NM_104360.3. |
| UniGene | At.16081. At.70639. |
3D structure databases | |
| ProteinModelPortal | Q9FZ42. |
| SMR | Q9FZ42. Positions 6-288. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 3702.AT1G54870.1-P. |
Proteomic databases | |
| PaxDb | Q9FZ42. |
| PRIDE | Q9FZ42. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 841926. |
| KEGG | ath:AT1G54870. |
Organism-specific databases | |
| TAIR | At1g54870. |
Phylogenomic databases | |
| eggNOG | COG1028. |
| InParanoid | Q9FZ42. |
| OMA | AYKGNAS. |
| PhylomeDB | Q9FZ42. |
Enzyme and pathway databases | |
| BioCyc | ARA:AT1G54870-MONOMER. MetaCyc:AT1G54870-MONOMER. |
Gene expression databases | |
| ArrayExpress | Q9FZ42. |
| Genevestigator | Q9FZ42. |
| GermOnline | AT1G54870. Arabidopsis thaliana. |
Family and domain databases | |
| Gene3D | 3.40.50.720. 1 hit. |
| InterPro | IPR002198. DH_sc/Rdtase_SDR. IPR002347. Glc/ribitol_DH. IPR016040. NAD(P)-bd_dom. IPR020904. Sc_DH/Rdtase_CS. [Graphical view] |
| PRINTS | PR00081. GDHRDH. PR00080. SDRFAMILY. |
| PROSITE | PS00061. ADH_SHORT. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | GRDH1_ARATH | ||||||||
| Accession | Primary (citable) accession number: Q9FZ42 Secondary accession number(s): Q42157, Q42225, Q9C7L3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Plant Protein Annotation Program | ||||||||
Relevant documents
| Arabidopsis thaliana Arabidopsis thaliana: entries and gene names |
| SIMILARITY comments Index of protein domains and families |

Clusters with
