Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable LRR receptor-like serine/threonine-protein kinase RFK1

Gene

RKF1

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei709ATPPROSITE-ProRule annotation1
Active sitei807Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi687 – 695ATPPROSITE-ProRule annotation9

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • protein serine/threonine kinase activity Source: TAIR
  • receptor signaling protein serine/threonine kinase activity Source: TAIR
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Receptor, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Probable LRR receptor-like serine/threonine-protein kinase RFK1 (EC:2.7.11.1)
Alternative name(s):
Receptor-like kinase in flowers 1
Gene namesi
Name:RKF1
Ordered Locus Names:At1g29750
ORF Names:F1N18.19, T3M22.1
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 1

Organism-specific databases

TAIRiAT1G29750.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini41 – 625ExtracellularSequence analysisAdd BLAST585
Transmembranei626 – 646HelicalSequence analysisAdd BLAST21
Topological domaini647 – 1021CytoplasmicSequence analysisAdd BLAST375

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 39Sequence analysisAdd BLAST39
ChainiPRO_000038751940 – 1021Probable LRR receptor-like serine/threonine-protein kinase RFK1Add BLAST982

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi96N-linked (GlcNAc...)Sequence analysis1
Glycosylationi136N-linked (GlcNAc...)Sequence analysis1
Glycosylationi147N-linked (GlcNAc...)Sequence analysis1
Glycosylationi168N-linked (GlcNAc...)Sequence analysis1
Glycosylationi218N-linked (GlcNAc...)Sequence analysis1
Glycosylationi287N-linked (GlcNAc...)Sequence analysis1
Glycosylationi300N-linked (GlcNAc...)Sequence analysis1
Glycosylationi486N-linked (GlcNAc...)Sequence analysis1
Glycosylationi512N-linked (GlcNAc...)Sequence analysis1
Modified residuei840PhosphoserineBy similarity1
Modified residuei841PhosphothreonineBy similarity1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ9FXF2.
PRIDEiQ9FXF2.

Expressioni

Tissue specificityi

Mostly expressed in flower buds, especially in stamens.1 Publication

Developmental stagei

First detected in early flower primordia and during stamen development. Later expressed in anthers and in pollen.1 Publication

Gene expression databases

GenevisibleiQ9FXF2. AT.

Interactioni

Protein-protein interaction databases

STRINGi3702.AT1G29750.2.

Structurei

3D structure databases

ProteinModelPortaliQ9FXF2.
SMRiQ9FXF2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati99 – 122LRR 1Add BLAST24
Repeati123 – 146LRR 2Add BLAST24
Repeati148 – 168LRR 3Add BLAST21
Repeati169 – 192LRR 4Add BLAST24
Repeati193 – 216LRR 5Add BLAST24
Repeati218 – 240LRR 6Add BLAST23
Repeati241 – 266LRR 7Add BLAST26
Repeati288 – 312LRR 8Add BLAST25
Repeati313 – 336LRR 9Add BLAST24
Repeati338 – 359LRR 10Add BLAST22
Repeati361 – 381LRR 11Add BLAST21
Domaini681 – 956Protein kinasePROSITE-ProRule annotationAdd BLAST276

Sequence similaritiesi

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.PROSITE-ProRule annotation
Contains 11 LRR (leucine-rich) repeats.Curated
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Keywords - Domaini

Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IU6K. Eukaryota.
COG0515. LUCA.
HOGENOMiHOG000116550.
InParanoidiQ9FXF2.
OMAiFKCPRYS.
OrthoDBiEOG093604FG.
PhylomeDBiQ9FXF2.

Family and domain databases

Gene3Di2.60.120.200. 1 hit.
3.80.10.10. 1 hit.
InterProiIPR013320. ConA-like_dom.
IPR011009. Kinase-like_dom.
IPR032675. L_dom-like.
IPR021720. Malectin.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF11721. Malectin. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF52058. SSF52058. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9FXF2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MISLYQILAE KKKKKKNDLN IFAFSVFAII CFKFYSVNAI KLPQQEVDAL
60 70 80 90 100
QQIATTLGSK FWKFDAENCK IEMVGLTETP PPTAKQEIEC ECSPTNDTDC
110 120 130 140 150
HVVKFAFKDH NLPGTLPQIV KLPYLREIDL AYNYINGTLP REWASSNLTF
160 170 180 190 200
ISLLVNRLSG EIPKEFGNSS LTYLDLESNA FSGTIPQELG NLVHLKKLLL
210 220 230 240 250
SSNKLTGTLP ASLARLQNMT DFRINDLQLS GTIPSYIQNW KQLERLEMIA
260 270 280 290 300
SGLTGPIPSV ISVLSNLVNL RISDIRGPVQ PFPSLKNVTG LTKIILKNCN
310 320 330 340 350
ISGQIPTYLS HLKELETLDL SFNKLVGGIP SFAQAENLRF IILAGNMLEG
360 370 380 390 400
DAPDELLRDG ITVDLSYNNL KWQSPESRAC RPNMNLNLNL FQSTSTKKSS
410 420 430 440 450
KFLPCIKDFK CPRYSSCLHV NCGGSDMYVK EKKTKELYEG DGNVEGGAAK
460 470 480 490 500
YFLKPDANWG FSSTGDFMDD NNFQNTRFTM FVPASNQSDL YKSARIAPVS
510 520 530 540 550
LTYFHACLEN GNYTINLDFA EIRFTNDENY NRLGRRLFDI YIQEKLVAKD
560 570 580 590 600
FNIMDEAKGA QTPIIKPLTA YVTNHFLTIR LSWAGKGTTR IPTRGVYGPI
610 620 630 640 650
ISAISIVSDS KPCERPKTGM SPGAYIAIGI GAPCLIIFIL GFLWICGCLP
660 670 680 690 700
RCGRQRKDPY EEELPSGTFT LRQIKFATDD FNPTNKIGEG GFGAVFKGVL
710 720 730 740 750
ADGRVVAVKQ LSSKSRQGNR EFLNEIGAIS CLQHPNLVKL HGFCVERAQL
760 770 780 790 800
LLAYEYMENN SLSSALFSPK HKQIPMDWPT RFKICCGIAK GLAFLHEESP
810 820 830 840 850
LKFVHRDIKA TNILLDKDLT PKISDFGLAR LDEEEKTHIS TKVAGTIGYM
860 870 880 890 900
APEYALWGYL TFKADVYSFG VLVLEIVAGI TNSNFMGAGD SVCLLEFANE
910 920 930 940 950
CVESGHLMQV VDERLRPEVD RKEAEAVIKV ALVCSSASPT DRPLMSEVVA
960 970 980 990 1000
MLEGLYPVPE STPGVSRNAG DIRFKAFKDL RRGMENNSKT QCSVKSYPSS
1010 1020
SSTSSGAGQA VQERKKEESR P
Length:1,021
Mass (Da):113,463
Last modified:March 1, 2001 - v1
Checksum:i9F35CBFEA5A1CC1A
GO
Isoform 2 (identifier: Q9FXF2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     3-46: SLYQILAEKKKKKKNDLNIFAFSVFAIICFKFYSVNAIKLPQQE → VKAKKSVILVVAQVIELIFYDVCFCVCSL

Show »
Length:1,006
Mass (Da):111,526
Checksum:i7A66A6E688A04974
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti25S → P in AAC50043 (PubMed:9687063).Curated1
Sequence conflicti398 – 408KSSKFLPCIKD → NRANFCRVSR in AAC50043 (PubMed:9687063).CuratedAdd BLAST11
Sequence conflicti434T → P in AAC50043 (PubMed:9687063).Curated1
Sequence conflicti927V → G in AAC50043 (PubMed:9687063).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0382773 – 46SLYQI…LPQQE → VKAKKSVILVVAQVIELIFY DVCFCVCSL in isoform 2. 2 PublicationsAdd BLAST44

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF024648 mRNA. Translation: AAC50043.1.
AC008030 Genomic DNA. Translation: AAG10619.1.
AC079288 Genomic DNA. Translation: AAG50773.1.
CP002684 Genomic DNA. Translation: AEE31124.1.
CP002684 Genomic DNA. Translation: AEE31125.1.
AY091006 mRNA. Translation: AAM14028.1.
AY142598 mRNA. Translation: AAN13167.1.
FJ708642 mRNA. Translation: ACN59238.1.
PIRiA86421.
RefSeqiNP_174268.7. NM_102715.8. [Q9FXF2-1]
NP_850955.5. NM_180624.6. [Q9FXF2-2]
UniGeneiAt.16300.

Genome annotation databases

EnsemblPlantsiAT1G29750.2; AT1G29750.2; AT1G29750. [Q9FXF2-1]
GeneIDi839853.
GrameneiAT1G29750.2; AT1G29750.2; AT1G29750.
KEGGiath:AT1G29750.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF024648 mRNA. Translation: AAC50043.1.
AC008030 Genomic DNA. Translation: AAG10619.1.
AC079288 Genomic DNA. Translation: AAG50773.1.
CP002684 Genomic DNA. Translation: AEE31124.1.
CP002684 Genomic DNA. Translation: AEE31125.1.
AY091006 mRNA. Translation: AAM14028.1.
AY142598 mRNA. Translation: AAN13167.1.
FJ708642 mRNA. Translation: ACN59238.1.
PIRiA86421.
RefSeqiNP_174268.7. NM_102715.8. [Q9FXF2-1]
NP_850955.5. NM_180624.6. [Q9FXF2-2]
UniGeneiAt.16300.

3D structure databases

ProteinModelPortaliQ9FXF2.
SMRiQ9FXF2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi3702.AT1G29750.2.

Proteomic databases

PaxDbiQ9FXF2.
PRIDEiQ9FXF2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT1G29750.2; AT1G29750.2; AT1G29750. [Q9FXF2-1]
GeneIDi839853.
GrameneiAT1G29750.2; AT1G29750.2; AT1G29750.
KEGGiath:AT1G29750.

Organism-specific databases

TAIRiAT1G29750.

Phylogenomic databases

eggNOGiENOG410IU6K. Eukaryota.
COG0515. LUCA.
HOGENOMiHOG000116550.
InParanoidiQ9FXF2.
OMAiFKCPRYS.
OrthoDBiEOG093604FG.
PhylomeDBiQ9FXF2.

Miscellaneous databases

PROiQ9FXF2.

Gene expression databases

GenevisibleiQ9FXF2. AT.

Family and domain databases

Gene3Di2.60.120.200. 1 hit.
3.80.10.10. 1 hit.
InterProiIPR013320. ConA-like_dom.
IPR011009. Kinase-like_dom.
IPR032675. L_dom-like.
IPR021720. Malectin.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF11721. Malectin. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF52058. SSF52058. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRKF1_ARATH
AccessioniPrimary (citable) accession number: Q9FXF2
Secondary accession number(s): O22579, Q8RWZ9, Q9C6G6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 3, 2009
Last sequence update: March 1, 2001
Last modified: November 30, 2016
This is version 115 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.