Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9FI53

- FUM2_ARATH

UniProt

Q9FI53 - FUM2_ARATH

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Fumarate hydratase 2, chloroplastic

Gene

FUM2

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli

Functioni

Catalytic activityi

(S)-malate = fumarate + H2O.

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei136 – 1361SubstrateBy similarity

GO - Molecular functioni

  1. fumarate hydratase activity Source: UniProtKB-EC

GO - Biological processi

  1. fumarate metabolic process Source: InterPro
  2. nitrate assimilation Source: TAIR
  3. response to salt stress Source: TAIR
  4. tricarboxylic acid cycle Source: UniProtKB-UniPathway
Complete GO annotation...

Keywords - Molecular functioni

Lyase

Keywords - Biological processi

Tricarboxylic acid cycle

Enzyme and pathway databases

BioCyciARA:AT5G50950-MONOMER.
ARA:GQT-2362-MONOMER.
ARA:GQT-2363-MONOMER.
MetaCyc:AT5G50950-MONOMER.
UniPathwayiUPA00223; UER01007.

Names & Taxonomyi

Protein namesi
Recommended name:
Fumarate hydratase 2, chloroplastic (EC:4.2.1.2)
Short name:
Fumarase 2
Gene namesi
Name:FUM2
Ordered Locus Names:At5g50950
ORF Names:K3K7.11
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
ProteomesiUP000006548: Chromosome 5

Organism-specific databases

TAIRiAT5G50950.

Subcellular locationi

Plastidchloroplast Curated

GO - Cellular componenti

  1. chloroplast Source: UniProtKB-KW
  2. cytosol Source: TAIR
  3. mitochondrion Source: TAIR
  4. tricarboxylic acid cycle enzyme complex Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Chloroplast, Plastid

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini? – 499Fumarate hydratase 2, chloroplasticPRO_0000010330
Transit peptidei1 – ?ChloroplastSequence Analysis

Proteomic databases

PaxDbiQ9FI53.
PRIDEiQ9FI53.

Expressioni

Gene expression databases

GenevestigatoriQ9FI53.

Interactioni

Protein-protein interaction databases

IntActiQ9FI53. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ9FI53.
SMRiQ9FI53. Positions 39-497.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni164 – 1674B siteBy similarity
Regioni174 – 1763Substrate bindingBy similarity

Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiCOG0114.
HOGENOMiHOG000061736.
InParanoidiQ9FI53.
KOiK01679.
OMAiMESFNIH.
PhylomeDBiQ9FI53.

Family and domain databases

Gene3Di1.10.275.10. 1 hit.
HAMAPiMF_00743. FumaraseC.
InterProiIPR005677. Fum_hydII.
IPR024083. Fumarase/histidase_N.
IPR018951. Fumarase_C_C.
IPR020557. Fumarate_lyase_CS.
IPR000362. Fumarate_lyase_fam.
IPR022761. Fumarate_lyase_N.
IPR008948. L-Aspartase-like.
[Graphical view]
PANTHERiPTHR11444. PTHR11444. 1 hit.
PfamiPF10415. FumaraseC_C. 1 hit.
PF00206. Lyase_1. 1 hit.
[Graphical view]
PRINTSiPR00149. FUMRATELYASE.
SUPFAMiSSF48557. SSF48557. 1 hit.
TIGRFAMsiTIGR00979. fumC_II. 1 hit.
PROSITEiPS00163. FUMARATE_LYASES. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9FI53-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAALTMQFEG EKKNVSEVAD VTLKQEDEQQ ERRSYSTPFR EERDTFGPIQ
60 70 80 90 100
VPSDKLWGAQ TQRSLQNFEI GGDRERMPEP IVRAFGVLKK CAAKVNMEYG
110 120 130 140 150
LDPMIGEAIM EAAQEVAEGK LNDHFPLVVW QTGSGTQSNM NANEVIANRA
160 170 180 190 200
AEILGHKRGE KIVHPNDHVN RSQSSNDTFP TVMHIAAATE ITSRLIPSLK
210 220 230 240 250
NLHSSLESKS FEFKDIVKIG RTHTQDATPL TLGQEFGGYA TQVEYGLNRV
260 270 280 290 300
ACTLPRIYQL AQGGTAVGTG LNTKKGFDVK IAAAVAEETN LPFVTAENKF
310 320 330 340 350
EALAAHDACV ETSGSLNTIA TSLMKIANDI RFLGSGPRCG LGELSLPENE
360 370 380 390 400
PGSSIMPGKV NPTQCEALTM VCAQVMGNHV AVTIGGSNGH FELNVFKPVI
410 420 430 440 450
ASALLHSIRL IADASASFEK NCVRGIEANR ERISKLLHES LMLVTSLNPK
460 470 480 490
IGYDNAAAVA KRAHKEGCTL KHAAMKLGVL TSEEFDTLVV PEKMIGPSD
Length:499
Mass (Da):54,084
Last modified:March 1, 2001 - v1
Checksum:iA84422EB032FCB4E
GO
Isoform 2 (identifier: Q9FI53-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     472-499: HAAMKLGVLTSEEFDTLVVPEKMIGPSD → VNNKLLTFSSLNKSEFKPIFSKRKHVHVCYNIFVVLFWI

Note: Derived from EST data. No experimental confirmation available.

Show »
Length:510
Mass (Da):55,766
Checksum:i4B192A14B3DD12D9
GO
Isoform 3 (identifier: Q9FI53-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     210-214: SFEFK → VTHLM
     215-499: Missing.

Note: No experimental confirmation available.

Show »
Length:214
Mass (Da):23,885
Checksum:iB56D413A83C88E25
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei210 – 2145SFEFK → VTHLM in isoform 3. 1 PublicationVSP_011356
Alternative sequencei215 – 499285Missing in isoform 3. 1 PublicationVSP_011357Add
BLAST
Alternative sequencei472 – 49928HAAMK…IGPSD → VNNKLLTFSSLNKSEFKPIF SKRKHVHVCYNIFVVLFWI in isoform 2. CuratedVSP_011355Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB017063 Genomic DNA. Translation: BAB08741.1.
CP002688 Genomic DNA. Translation: AED96014.1.
CP002688 Genomic DNA. Translation: AED96015.1.
AY052197 mRNA. Translation: AAK97668.1.
AY072393 mRNA. Translation: AAL62385.1.
AY113070 mRNA. Translation: AAM47378.1.
RefSeqiNP_199908.1. NM_124474.3. [Q9FI53-1]
NP_851166.1. NM_180835.2. [Q9FI53-2]
UniGeneiAt.6963.

Genome annotation databases

EnsemblPlantsiAT5G50950.2; AT5G50950.2; AT5G50950. [Q9FI53-1]
GeneIDi835168.
KEGGiath:AT5G50950.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB017063 Genomic DNA. Translation: BAB08741.1 .
CP002688 Genomic DNA. Translation: AED96014.1 .
CP002688 Genomic DNA. Translation: AED96015.1 .
AY052197 mRNA. Translation: AAK97668.1 .
AY072393 mRNA. Translation: AAL62385.1 .
AY113070 mRNA. Translation: AAM47378.1 .
RefSeqi NP_199908.1. NM_124474.3. [Q9FI53-1 ]
NP_851166.1. NM_180835.2. [Q9FI53-2 ]
UniGenei At.6963.

3D structure databases

ProteinModelPortali Q9FI53.
SMRi Q9FI53. Positions 39-497.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q9FI53. 1 interaction.

Proteomic databases

PaxDbi Q9FI53.
PRIDEi Q9FI53.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblPlantsi AT5G50950.2 ; AT5G50950.2 ; AT5G50950 . [Q9FI53-1 ]
GeneIDi 835168.
KEGGi ath:AT5G50950.

Organism-specific databases

GeneFarmi 4371. 440.
TAIRi AT5G50950.

Phylogenomic databases

eggNOGi COG0114.
HOGENOMi HOG000061736.
InParanoidi Q9FI53.
KOi K01679.
OMAi MESFNIH.
PhylomeDBi Q9FI53.

Enzyme and pathway databases

UniPathwayi UPA00223 ; UER01007 .
BioCyci ARA:AT5G50950-MONOMER.
ARA:GQT-2362-MONOMER.
ARA:GQT-2363-MONOMER.
MetaCyc:AT5G50950-MONOMER.

Gene expression databases

Genevestigatori Q9FI53.

Family and domain databases

Gene3Di 1.10.275.10. 1 hit.
HAMAPi MF_00743. FumaraseC.
InterProi IPR005677. Fum_hydII.
IPR024083. Fumarase/histidase_N.
IPR018951. Fumarase_C_C.
IPR020557. Fumarate_lyase_CS.
IPR000362. Fumarate_lyase_fam.
IPR022761. Fumarate_lyase_N.
IPR008948. L-Aspartase-like.
[Graphical view ]
PANTHERi PTHR11444. PTHR11444. 1 hit.
Pfami PF10415. FumaraseC_C. 1 hit.
PF00206. Lyase_1. 1 hit.
[Graphical view ]
PRINTSi PR00149. FUMRATELYASE.
SUPFAMi SSF48557. SSF48557. 1 hit.
TIGRFAMsi TIGR00979. fumC_II. 1 hit.
PROSITEi PS00163. FUMARATE_LYASES. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Structural analysis of Arabidopsis thaliana chromosome 5. IX. Sequence features of the regions of 1,011,550 bp covered by seventeen P1 and TAC clones."
    Kaneko T., Katoh T., Sato S., Nakamura Y., Asamizu E., Kotani H., Miyajima N., Tabata S.
    DNA Res. 6:183-195(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: cv. Columbia.
  2. The Arabidopsis Information Resource (TAIR)
    Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
    Cited for: GENOME REANNOTATION.
    Strain: cv. Columbia.
  3. "Empirical analysis of transcriptional activity in the Arabidopsis genome."
    Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.
    , Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J., Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y., Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P., Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F., Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M., Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J., Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T., Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y., Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.
    Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Strain: cv. Columbia.

Entry informationi

Entry nameiFUM2_ARATH
AccessioniPrimary (citable) accession number: Q9FI53
Secondary accession number(s): Q8VY72
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 15, 2003
Last sequence update: March 1, 2001
Last modified: October 29, 2014
This is version 108 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Miscellaneous

There are 2 substrate-binding sites: the catalytic A site, and the non-catalytic B site that may play a role in the transfer of substrate or product between the active site and the solvent. Alternatively, the B site may bind allosteric effectors (By similarity).By similarity

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3