Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9FI53

- FUM2_ARATH

UniProt

Q9FI53 - FUM2_ARATH

Protein

Fumarate hydratase 2, chloroplastic

Gene

FUM2

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 107 (01 Oct 2014)
      Sequence version 1 (01 Mar 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalytic activityi

    (S)-malate = fumarate + H2O.

    Pathwayi

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei136 – 1361SubstrateBy similarity

    GO - Molecular functioni

    1. fumarate hydratase activity Source: UniProtKB-EC
    2. protein binding Source: TAIR

    GO - Biological processi

    1. fumarate metabolic process Source: InterPro
    2. nitrate assimilation Source: TAIR
    3. response to salt stress Source: TAIR
    4. tricarboxylic acid cycle Source: UniProtKB-UniPathway

    Keywords - Molecular functioni

    Lyase

    Keywords - Biological processi

    Tricarboxylic acid cycle

    Enzyme and pathway databases

    BioCyciARA:AT5G50950-MONOMER.
    ARA:GQT-2362-MONOMER.
    ARA:GQT-2363-MONOMER.
    MetaCyc:AT5G50950-MONOMER.
    UniPathwayiUPA00223; UER01007.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Fumarate hydratase 2, chloroplastic (EC:4.2.1.2)
    Short name:
    Fumarase 2
    Gene namesi
    Name:FUM2
    Ordered Locus Names:At5g50950
    ORF Names:K3K7.11
    OrganismiArabidopsis thaliana (Mouse-ear cress)
    Taxonomic identifieri3702 [NCBI]
    Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
    ProteomesiUP000006548: Chromosome 5

    Organism-specific databases

    TAIRiAT5G50950.

    Subcellular locationi

    Plastidchloroplast Curated

    GO - Cellular componenti

    1. chloroplast Source: UniProtKB-SubCell
    2. cytosol Source: TAIR
    3. mitochondrion Source: TAIR
    4. tricarboxylic acid cycle enzyme complex Source: InterPro

    Keywords - Cellular componenti

    Chloroplast, Plastid

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini? – 499Fumarate hydratase 2, chloroplasticPRO_0000010330
    Transit peptidei1 – ?ChloroplastSequence Analysis

    Proteomic databases

    PaxDbiQ9FI53.
    PRIDEiQ9FI53.

    Expressioni

    Gene expression databases

    GenevestigatoriQ9FI53.

    Interactioni

    Protein-protein interaction databases

    IntActiQ9FI53. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9FI53.
    SMRiQ9FI53. Positions 39-497.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni164 – 1674B siteBy similarity
    Regioni174 – 1763Substrate bindingBy similarity

    Sequence similaritiesi

    Keywords - Domaini

    Transit peptide

    Phylogenomic databases

    eggNOGiCOG0114.
    HOGENOMiHOG000061736.
    InParanoidiQ9FI53.
    KOiK01679.
    OMAiMESFNIH.
    PhylomeDBiQ9FI53.

    Family and domain databases

    Gene3Di1.10.275.10. 1 hit.
    HAMAPiMF_00743. FumaraseC.
    InterProiIPR005677. Fum_hydII.
    IPR024083. Fumarase/histidase_N.
    IPR018951. Fumarase_C_C.
    IPR020557. Fumarate_lyase_CS.
    IPR000362. Fumarate_lyase_fam.
    IPR022761. Fumarate_lyase_N.
    IPR008948. L-Aspartase-like.
    [Graphical view]
    PANTHERiPTHR11444. PTHR11444. 1 hit.
    PfamiPF10415. FumaraseC_C. 1 hit.
    PF00206. Lyase_1. 1 hit.
    [Graphical view]
    PRINTSiPR00149. FUMRATELYASE.
    SUPFAMiSSF48557. SSF48557. 1 hit.
    TIGRFAMsiTIGR00979. fumC_II. 1 hit.
    PROSITEiPS00163. FUMARATE_LYASES. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9FI53-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAALTMQFEG EKKNVSEVAD VTLKQEDEQQ ERRSYSTPFR EERDTFGPIQ    50
    VPSDKLWGAQ TQRSLQNFEI GGDRERMPEP IVRAFGVLKK CAAKVNMEYG 100
    LDPMIGEAIM EAAQEVAEGK LNDHFPLVVW QTGSGTQSNM NANEVIANRA 150
    AEILGHKRGE KIVHPNDHVN RSQSSNDTFP TVMHIAAATE ITSRLIPSLK 200
    NLHSSLESKS FEFKDIVKIG RTHTQDATPL TLGQEFGGYA TQVEYGLNRV 250
    ACTLPRIYQL AQGGTAVGTG LNTKKGFDVK IAAAVAEETN LPFVTAENKF 300
    EALAAHDACV ETSGSLNTIA TSLMKIANDI RFLGSGPRCG LGELSLPENE 350
    PGSSIMPGKV NPTQCEALTM VCAQVMGNHV AVTIGGSNGH FELNVFKPVI 400
    ASALLHSIRL IADASASFEK NCVRGIEANR ERISKLLHES LMLVTSLNPK 450
    IGYDNAAAVA KRAHKEGCTL KHAAMKLGVL TSEEFDTLVV PEKMIGPSD 499
    Length:499
    Mass (Da):54,084
    Last modified:March 1, 2001 - v1
    Checksum:iA84422EB032FCB4E
    GO
    Isoform 2 (identifier: Q9FI53-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         472-499: HAAMKLGVLTSEEFDTLVVPEKMIGPSD → VNNKLLTFSSLNKSEFKPIFSKRKHVHVCYNIFVVLFWI

    Note: Derived from EST data. No experimental confirmation available.

    Show »
    Length:510
    Mass (Da):55,766
    Checksum:i4B192A14B3DD12D9
    GO
    Isoform 3 (identifier: Q9FI53-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         210-214: SFEFK → VTHLM
         215-499: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:214
    Mass (Da):23,885
    Checksum:iB56D413A83C88E25
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei210 – 2145SFEFK → VTHLM in isoform 3. 1 PublicationVSP_011356
    Alternative sequencei215 – 499285Missing in isoform 3. 1 PublicationVSP_011357Add
    BLAST
    Alternative sequencei472 – 49928HAAMK…IGPSD → VNNKLLTFSSLNKSEFKPIF SKRKHVHVCYNIFVVLFWI in isoform 2. CuratedVSP_011355Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB017063 Genomic DNA. Translation: BAB08741.1.
    CP002688 Genomic DNA. Translation: AED96014.1.
    CP002688 Genomic DNA. Translation: AED96015.1.
    AY052197 mRNA. Translation: AAK97668.1.
    AY072393 mRNA. Translation: AAL62385.1.
    AY113070 mRNA. Translation: AAM47378.1.
    RefSeqiNP_199908.1. NM_124474.3. [Q9FI53-1]
    NP_851166.1. NM_180835.2. [Q9FI53-2]
    UniGeneiAt.6963.

    Genome annotation databases

    EnsemblPlantsiAT5G50950.2; AT5G50950.2; AT5G50950. [Q9FI53-1]
    GeneIDi835168.
    KEGGiath:AT5G50950.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB017063 Genomic DNA. Translation: BAB08741.1 .
    CP002688 Genomic DNA. Translation: AED96014.1 .
    CP002688 Genomic DNA. Translation: AED96015.1 .
    AY052197 mRNA. Translation: AAK97668.1 .
    AY072393 mRNA. Translation: AAL62385.1 .
    AY113070 mRNA. Translation: AAM47378.1 .
    RefSeqi NP_199908.1. NM_124474.3. [Q9FI53-1 ]
    NP_851166.1. NM_180835.2. [Q9FI53-2 ]
    UniGenei At.6963.

    3D structure databases

    ProteinModelPortali Q9FI53.
    SMRi Q9FI53. Positions 39-497.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q9FI53. 1 interaction.

    Proteomic databases

    PaxDbi Q9FI53.
    PRIDEi Q9FI53.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    EnsemblPlantsi AT5G50950.2 ; AT5G50950.2 ; AT5G50950 . [Q9FI53-1 ]
    GeneIDi 835168.
    KEGGi ath:AT5G50950.

    Organism-specific databases

    GeneFarmi 4371. 440.
    TAIRi AT5G50950.

    Phylogenomic databases

    eggNOGi COG0114.
    HOGENOMi HOG000061736.
    InParanoidi Q9FI53.
    KOi K01679.
    OMAi MESFNIH.
    PhylomeDBi Q9FI53.

    Enzyme and pathway databases

    UniPathwayi UPA00223 ; UER01007 .
    BioCyci ARA:AT5G50950-MONOMER.
    ARA:GQT-2362-MONOMER.
    ARA:GQT-2363-MONOMER.
    MetaCyc:AT5G50950-MONOMER.

    Gene expression databases

    Genevestigatori Q9FI53.

    Family and domain databases

    Gene3Di 1.10.275.10. 1 hit.
    HAMAPi MF_00743. FumaraseC.
    InterProi IPR005677. Fum_hydII.
    IPR024083. Fumarase/histidase_N.
    IPR018951. Fumarase_C_C.
    IPR020557. Fumarate_lyase_CS.
    IPR000362. Fumarate_lyase_fam.
    IPR022761. Fumarate_lyase_N.
    IPR008948. L-Aspartase-like.
    [Graphical view ]
    PANTHERi PTHR11444. PTHR11444. 1 hit.
    Pfami PF10415. FumaraseC_C. 1 hit.
    PF00206. Lyase_1. 1 hit.
    [Graphical view ]
    PRINTSi PR00149. FUMRATELYASE.
    SUPFAMi SSF48557. SSF48557. 1 hit.
    TIGRFAMsi TIGR00979. fumC_II. 1 hit.
    PROSITEi PS00163. FUMARATE_LYASES. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Structural analysis of Arabidopsis thaliana chromosome 5. IX. Sequence features of the regions of 1,011,550 bp covered by seventeen P1 and TAC clones."
      Kaneko T., Katoh T., Sato S., Nakamura Y., Asamizu E., Kotani H., Miyajima N., Tabata S.
      DNA Res. 6:183-195(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: cv. Columbia.
    2. The Arabidopsis Information Resource (TAIR)
      Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
      Cited for: GENOME REANNOTATION.
      Strain: cv. Columbia.
    3. "Empirical analysis of transcriptional activity in the Arabidopsis genome."
      Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.
      , Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J., Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y., Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P., Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F., Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M., Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J., Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T., Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y., Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.
      Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Strain: cv. Columbia.

    Entry informationi

    Entry nameiFUM2_ARATH
    AccessioniPrimary (citable) accession number: Q9FI53
    Secondary accession number(s): Q8VY72
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 15, 2003
    Last sequence update: March 1, 2001
    Last modified: October 1, 2014
    This is version 107 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programPlant Protein Annotation Program

    Miscellaneousi

    Miscellaneous

    There are 2 substrate-binding sites: the catalytic A site, and the non-catalytic B site that may play a role in the transfer of substrate or product between the active site and the solvent. Alternatively, the B site may bind allosteric effectors By similarity.By similarity

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Arabidopsis thaliana
      Arabidopsis thaliana: entries and gene names
    2. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3