Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9FI53 (FUM2_ARATH) Reviewed, UniProtKB/Swiss-Prot

Last modified June 11, 2014. Version 106. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Fumarate hydratase 2, chloroplastic

Short name=Fumarase 2
EC=4.2.1.2
Gene names
Name:FUM2
Ordered Locus Names:At5g50950
ORF Names:K3K7.11
OrganismArabidopsis thaliana (Mouse-ear cress) [Reference proteome]
Taxonomic identifier3702 [NCBI]
Taxonomic lineageEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis

Protein attributes

Sequence length499 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Catalytic activity

(S)-malate = fumarate + H2O. HAMAP-Rule MF_00743

Pathway

Carbohydrate metabolism; tricarboxylic acid cycle; (S)-malate from fumarate: step 1/1. HAMAP-Rule MF_00743

Subcellular location

Plastidchloroplast Potential HAMAP-Rule MF_00743.

Miscellaneous

There are 2 substrate-binding sites: the catalytic A site, and the non-catalytic B site that may play a role in the transfer of substrate or product between the active site and the solvent. Alternatively, the B site may bind allosteric effectors By similarity.

Sequence similarities

Belongs to the class-II fumarase/aspartase family. Fumarase subfamily.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9FI53-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9FI53-2)

The sequence of this isoform differs from the canonical sequence as follows:
     472-499: HAAMKLGVLTSEEFDTLVVPEKMIGPSD → VNNKLLTFSSLNKSEFKPIFSKRKHVHVCYNIFVVLFWI
Note: Derived from EST data. No experimental confirmation available.
Isoform 3 (identifier: Q9FI53-3)

The sequence of this isoform differs from the canonical sequence as follows:
     210-214: SFEFK → VTHLM
     215-499: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Transit peptide1 – ?Chloroplast Potential
Chain? – 499Fumarate hydratase 2, chloroplastic HAMAP-Rule MF_00743PRO_0000010330

Regions

Region164 – 1674B site By similarity
Region174 – 1763Substrate binding By similarity

Sites

Binding site1361Substrate By similarity

Natural variations

Alternative sequence210 – 2145SFEFK → VTHLM in isoform 3.
VSP_011356
Alternative sequence215 – 499285Missing in isoform 3.
VSP_011357
Alternative sequence472 – 49928HAAMK…IGPSD → VNNKLLTFSSLNKSEFKPIF SKRKHVHVCYNIFVVLFWI in isoform 2.
VSP_011355

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 1, 2001. Version 1.
Checksum: A84422EB032FCB4E

FASTA49954,084
        10         20         30         40         50         60 
MAALTMQFEG EKKNVSEVAD VTLKQEDEQQ ERRSYSTPFR EERDTFGPIQ VPSDKLWGAQ 

        70         80         90        100        110        120 
TQRSLQNFEI GGDRERMPEP IVRAFGVLKK CAAKVNMEYG LDPMIGEAIM EAAQEVAEGK 

       130        140        150        160        170        180 
LNDHFPLVVW QTGSGTQSNM NANEVIANRA AEILGHKRGE KIVHPNDHVN RSQSSNDTFP 

       190        200        210        220        230        240 
TVMHIAAATE ITSRLIPSLK NLHSSLESKS FEFKDIVKIG RTHTQDATPL TLGQEFGGYA 

       250        260        270        280        290        300 
TQVEYGLNRV ACTLPRIYQL AQGGTAVGTG LNTKKGFDVK IAAAVAEETN LPFVTAENKF 

       310        320        330        340        350        360 
EALAAHDACV ETSGSLNTIA TSLMKIANDI RFLGSGPRCG LGELSLPENE PGSSIMPGKV 

       370        380        390        400        410        420 
NPTQCEALTM VCAQVMGNHV AVTIGGSNGH FELNVFKPVI ASALLHSIRL IADASASFEK 

       430        440        450        460        470        480 
NCVRGIEANR ERISKLLHES LMLVTSLNPK IGYDNAAAVA KRAHKEGCTL KHAAMKLGVL 

       490 
TSEEFDTLVV PEKMIGPSD 

« Hide

Isoform 2 [UniParc].

Checksum: 4B192A14B3DD12D9
Show »

FASTA51055,766
Isoform 3 [UniParc].

Checksum: B56D413A83C88E25
Show »

FASTA21423,885

References

« Hide 'large scale' references
[1]"Structural analysis of Arabidopsis thaliana chromosome 5. IX. Sequence features of the regions of 1,011,550 bp covered by seventeen P1 and TAC clones."
Kaneko T., Katoh T., Sato S., Nakamura Y., Asamizu E., Kotani H., Miyajima N., Tabata S.
DNA Res. 6:183-195(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: cv. Columbia.
[2]The Arabidopsis Information Resource (TAIR)
Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
Cited for: GENOME REANNOTATION.
Strain: cv. Columbia.
[3]"Empirical analysis of transcriptional activity in the Arabidopsis genome."
Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G. expand/collapse author list , Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J., Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y., Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P., Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F., Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M., Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J., Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T., Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y., Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.
Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
Strain: cv. Columbia.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB017063 Genomic DNA. Translation: BAB08741.1.
CP002688 Genomic DNA. Translation: AED96014.1.
CP002688 Genomic DNA. Translation: AED96015.1.
AY052197 mRNA. Translation: AAK97668.1.
AY072393 mRNA. Translation: AAL62385.1.
AY113070 mRNA. Translation: AAM47378.1.
RefSeqNP_199908.1. NM_124474.3. [Q9FI53-1]
NP_851166.1. NM_180835.2. [Q9FI53-2]
UniGeneAt.6963.

3D structure databases

ProteinModelPortalQ9FI53.
SMRQ9FI53. Positions 39-497.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActQ9FI53. 1 interaction.

Proteomic databases

PaxDbQ9FI53.
PRIDEQ9FI53.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsAT5G50950.2; AT5G50950.2; AT5G50950. [Q9FI53-1]
GeneID835168.
KEGGath:AT5G50950.

Organism-specific databases

GeneFarm4371. 440.
TAIRAT5G50950.

Phylogenomic databases

eggNOGCOG0114.
HOGENOMHOG000061736.
InParanoidQ9FI53.
KOK01679.
OMAMESFNIH.
PhylomeDBQ9FI53.

Enzyme and pathway databases

BioCycARA:AT5G50950-MONOMER.
ARA:GQT-2362-MONOMER.
ARA:GQT-2363-MONOMER.
MetaCyc:AT5G50950-MONOMER.
UniPathwayUPA00223; UER01007.

Gene expression databases

GenevestigatorQ9FI53.

Family and domain databases

Gene3D1.10.275.10. 1 hit.
HAMAPMF_00743. FumaraseC.
InterProIPR005677. Fum_hydII.
IPR024083. Fumarase/histidase_N.
IPR018951. Fumarase_C_C.
IPR020557. Fumarate_lyase_CS.
IPR000362. Fumarate_lyase_fam.
IPR022761. Fumarate_lyase_N.
IPR008948. L-Aspartase-like.
[Graphical view]
PANTHERPTHR11444. PTHR11444. 1 hit.
PfamPF10415. FumaraseC_C. 1 hit.
PF00206. Lyase_1. 1 hit.
[Graphical view]
PRINTSPR00149. FUMRATELYASE.
SUPFAMSSF48557. SSF48557. 1 hit.
TIGRFAMsTIGR00979. fumC_II. 1 hit.
PROSITEPS00163. FUMARATE_LYASES. 1 hit.
[Graphical view]
ProtoNetSearch...

Entry information

Entry nameFUM2_ARATH
AccessionPrimary (citable) accession number: Q9FI53
Secondary accession number(s): Q8VY72
Entry history
Integrated into UniProtKB/Swiss-Prot: December 15, 2003
Last sequence update: March 1, 2001
Last modified: June 11, 2014
This is version 106 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

PATHWAY comments

Index of metabolic and biosynthesis pathways

Arabidopsis thaliana

Arabidopsis thaliana: entries and gene names