Q9FI53 (FUM2_ARATH) Reviewed, UniProtKB/Swiss-Prot
Last modified
November 16, 2011.
Version 84.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Fumarate hydratase 2, chloroplastic Short name=Fumarase 2 EC=4.2.1.2 | ||||||
| Gene names |
| ||||||
| Organism | Arabidopsis thaliana (Mouse-ear cress) | ||||||
| Taxonomic identifier | 3702 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › eudicotyledons › core eudicotyledons › rosids › malvids › Brassicales › Brassicaceae › Camelineae › Arabidopsis |
Protein attributes
| Sequence length | 499 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Catalytic activity | (S)-malate = fumarate + H2O. |
| Pathway | Carbohydrate metabolism; tricarboxylic acid cycle; (S)-malate from fumarate: step 1/1. |
| Subcellular location | Plastid › chloroplast Potential. |
| Miscellaneous | There are 2 substrate binding sites: the catalytic A site, and the non-catalytic B site that may play a role in the transfer of substrate or product between the active site and the solvent. Alternatively, the B site may bind allosteric effectors By similarity. |
| Sequence similarities | Belongs to the class-II fumarase/aspartase family. Fumarase subfamily. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9FI53-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9FI53-2) The sequence of this isoform differs from the canonical sequence as follows: 472-499: HAAMKLGVLTSEEFDTLVVPEKMIGPSD → VNNKLLTFSSLNKSEFKPIFSKRKHVHVCYNIFVVLFWI | ||||||
| Note: Derived from EST data. No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9FI53-3) The sequence of this isoform differs from the canonical sequence as follows: 210-214: SFEFK → VTHLM 215-499: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – ? | Chloroplast Potential | |||||||
| Chain | ? – 499 | Fumarate hydratase 2, chloroplastic | PRO_0000010330 | ||||||
Regions | |||||||||
| Region | 164 – 167 | 4 | B site By similarity | ||||||
| Region | 174 – 176 | 3 | Substrate binding By similarity | ||||||
Sites | |||||||||
| Binding site | 136 | 1 | Substrate By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 210 – 214 | 5 | SFEFK → VTHLM in isoform 3. | VSP_011356 | |||||
| Alternative sequence | 215 – 499 | 285 | Missing in isoform 3. | VSP_011357 | |||||
| Alternative sequence | 472 – 499 | 28 | HAAMK…IGPSD → VNNKLLTFSSLNKSEFKPIF SKRKHVHVCYNIFVVLFWI in isoform 2. | VSP_011355 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structural analysis of Arabidopsis thaliana chromosome 5. IX. Sequence features of the regions of 1,011,550 bp covered by seventeen P1 and TAC clones." Kaneko T., Katoh T., Sato S., Nakamura Y., Asamizu E., Kotani H., Miyajima N., Tabata S. DNA Res. 6:183-195(1999) [PubMed: 10470850] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: cv. Columbia. |
| [2] | The Arabidopsis Information Resource (TAIR) Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases Cited for: GENOME REANNOTATION. Strain: cv. Columbia. |
| [3] | "Empirical analysis of transcriptional activity in the Arabidopsis genome." Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G. Ecker J.R.Science 302:842-846(2003) [PubMed: 14593172] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Strain: cv. Columbia. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB017063 Genomic DNA. Translation: BAB08741.1. CP002688 Genomic DNA. Translation: AED96014.1. CP002688 Genomic DNA. Translation: AED96015.1. AY052197 mRNA. Translation: AAK97668.1. AY072393 mRNA. Translation: AAL62385.1. AY113070 mRNA. Translation: AAM47378.1. |
| IPI | IPI00525062. IPI00526175. IPI00546845. |
| RefSeq | NP_199908.1. NM_124474.3. NP_851166.1. NM_180835.2. |
| UniGene | At.6963. |
3D structure databases | |
| ProteinModelPortal | Q9FI53. |
| SMR | Q9FI53. Positions 39-497. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9FI53. 1 interaction. |
| STRING | Q9FI53. |
Proteomic databases | |
| PRIDE | Q9FI53. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblPlants | AT5G50950.2; AT5G50950.2; AT5G50950. |
| GeneID | 835168. |
| GenomeReviews | Gene locus AT5G50950 in contig BA000015_GR. |
| KEGG | ath:AT5G50950. |
| NMPDR | fig|3702.1.peg.26958. |
Organism-specific databases | |
| GeneFarm | 4371. 440. |
| TAIR | At5g50950. |
Phylogenomic databases | |
| eggNOG | KOG1317. |
| GeneTree | EPGT00050000008782. |
| HOGENOM | HBG284369. |
| InParanoid | Q9FI53. |
| OMA | VESDAFG. |
| PhylomeDB | Q9FI53. |
| ProtClustDB | PLN00134. |
Enzyme and pathway databases | |
| BioCyc | ARA:AT5G50950-MONOMER. MetaCyc:AT5G50950-MONOMER. |
Gene expression databases | |
| ArrayExpress | Q9FI53. |
| Genevestigator | Q9FI53. |
| GermOnline | AT5G50950. Arabidopsis thaliana. |
Family and domain databases | |
| InterPro | IPR005677. Fum_hydII. IPR018951. Fumarase_C_C. IPR000362. Fumarate_lyase. IPR020557. Fumarate_lyase_CS. IPR008948. L-Aspartase-like. IPR024083. L-Aspartase-like_N. IPR022761. Lyase1_N. [Graphical view] |
| Gene3D | G3DSA:1.10.275.10. G3DSA:1.10.275.10. 1 hit. |
| KO | K01679. |
| Pfam | PF10415. FumaraseC_C. 1 hit. PF00206. Lyase_1. 1 hit. [Graphical view] |
| PRINTS | PR00149. FUMRATELYASE. |
| SUPFAM | SSF48557. L-Aspartase-like. 1 hit. |
| TIGRFAMs | TIGR00979. FumC_II. 1 hit. |
| PROSITE | PS00163. FUMARATE_LYASES. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | FUM2_ARATH | ||||||||
| Accession | Primary (citable) accession number: Q9FI53 Secondary accession number(s): Q8VY72 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Plant Protein Annotation Program | ||||||||
Relevant documents
| Arabidopsis thaliana Arabidopsis thaliana: entries and gene names |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with