Reviewed,
UniProtKB/Swiss-Prot Q9FI53 (FUM2_ARATH)
Last modified
November 3, 2009.
Version 67.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Fumarate hydratase 2, chloroplastic Short name=Fumarase 2 EC=4.2.1.2 | ||||||
| Gene names |
| ||||||
| Organism | Arabidopsis thaliana (Mouse-ear cress) [Complete proteome] | ||||||
| Taxonomic identifier | 3702 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › eudicotyledons › core eudicotyledons › rosids › eurosids II › Brassicales › Brassicaceae › Arabidopsis |
Protein attributes
| Sequence length | 499 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Catalytic activity | (S)-malate = fumarate + H2O. |
| Pathway | |
| Subcellular location | Plastid › chloroplast Potential. |
| Miscellaneous | There are 2 substrate binding sites: the catalytic A site, and the non-catalytic B site that may play a role in the transfer of substrate or product between the active site and the solvent. Alternatively, the B site may bind allosteric effectors By similarity. |
| Sequence similarities | Belongs to the class-II fumarase/aspartase family. Fumarase subfamily. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Tricarboxylic acid cycle |
| Cellular component | Chloroplast Plastid |
| Coding sequence diversity | Alternative splicing |
| Domain | Transit peptide |
| Molecular function | Lyase |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | fumarate metabolic process Inferred from electronic annotation. Source: InterPro response to salt stressInferred from expression pattern. Source: TAIR tricarboxylic acid cycleInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | chloroplast Inferred from electronic annotation. Source: UniProtKB-SubCell mitochondrionInferred from direct assay. Source: TAIR tricarboxylic acid cycle enzyme complexInferred from electronic annotation. Source: InterPro |
| Molecular function | fumarate hydratase activity Inferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9FI53-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9FI53-2) The sequence of this isoform differs from the canonical sequence as follows: 472-499: HAAMKLGVLTSEEFDTLVVPEKMIGPSD → VNNKLLTFSSLNKSEFKPIFSKRKHVHVCYNIFVVLFWI | ||||||
| Note: Derived from EST data. No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9FI53-3) The sequence of this isoform differs from the canonical sequence as follows: 210-214: SFEFK → VTHLM 215-499: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – ? | Chloroplast Potential | |||||||
| Chain | ? – 499 | Fumarate hydratase 2, chloroplastic | PRO_0000010330 | ||||||
Regions | |||||||||
| Region | 164 – 167 | 4 | B site By similarity | ||||||
| Region | 174 – 176 | 3 | Substrate binding By similarity | ||||||
Sites | |||||||||
| Binding site | 136 | 1 | Substrate By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 210 – 214 | 5 | SFEFK → VTHLM in isoform 3. | VSP_011356 | |||||
| Alternative sequence | 215 – 499 | 285 | Missing in isoform 3. | VSP_011357 | |||||
| Alternative sequence | 472 – 499 | 28 | HAAMK…IGPSD → VNNKLLTFSSLNKSEFKPIF SKRKHVHVCYNIFVVLFWI in isoform 2. | VSP_011355 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "Structural analysis of Arabidopsis thaliana chromosome 5. IX. Sequence features of the regions of 1,011,550 bp covered by seventeen P1 and TAC clones." Kaneko T., Katoh T., Sato S., Nakamura Y., Asamizu E., Kotani H., Miyajima N., Tabata S. DNA Res. 6:183-195(1999) [PubMed: 10470850] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: cv. Columbia. |
| [2] | "Empirical analysis of transcriptional activity in the Arabidopsis genome." Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G. Ecker J.R.Science 302:842-846(2003) [PubMed: 14593172] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Strain: cv. Columbia. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AB017063 Genomic DNA. Translation: BAB08741.1. AY052197 mRNA. Translation: AAK97668.1. AY072393 mRNA. Translation: AAL62385.1. AY113070 mRNA. Translation: AAM47378.1. | |
| IPI | IPI00525062. IPI00526175. IPI00546845. |
| RefSeq | NP_199908.1. |
| UniGene | At.10398 At.6963 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1YFM based on UniProtKB P08417. |
| SMR | Q9FI53. Positions 39-495. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9FI53. |
Proteomic databases | |
| PRIDE | Q9FI53. |
Genome annotation databases | |
| GeneID | 835168. |
| GenomeReviews | Gene locus AT5G50950 in contig BA000015_GR. |
| NMPDR | fig|3702.1.peg.26958. |
Organism-specific databases | |
| GeneFarm | 4371. 440. |
| TAIR | At5g50950. |
Phylogenomic databases | |
| OMA | DATPITF. |
Enzyme and pathway databases | |
| BRENDA | 4.2.1.2. 302. |
Gene expression databases | |
| ArrayExpress | Q9FI53. |
| Genevestigator | Q9FI53. |
| GermOnline | AT5G50950. Arabidopsis thaliana. |
Family and domain databases | |
| InterPro | IPR005677. Fum_hydII. IPR018951. Fumarase_C_C. IPR000362. Fumarate_lyase. IPR020557. Fumarate_lyase_CS. [Graphical view] |
| Pfam | PF10415. FumaraseC_C. 1 hit. PF00206. Lyase_1. 1 hit. [Graphical view] |
| PRINTS | PR00149. FUMRATELYASE. |
| TIGRFAMs | TIGR00979. fumC_II. 1 hit. |
| PROSITE | PS00163. FUMARATE_LYASES. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | FUM2_ARATH | ||||||||
| Accession | Primary (citable) accession number: Q9FI53 Secondary accession number(s): Q8VY72 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | PPAP (Plant Proteome Annotation Project) | ||||||||
Relevant documents
| Arabidopsis thaliana Arabidopsis thaliana: entries and gene names |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with


