Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Palladin

Gene

Palld

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cytoskeletal protein required for organization of normal actin cytoskeleton. Roles in establishing cell morphology, motility, cell adhesion and cell-extracellular matrix interactions in a variety of cell types. May function as a scaffolding molecule with the potential to influence both actin polymerization and the assembly of existing actin filaments into higher-order arrays. Binds to proteins that bind to either monomeric or filamentous actin. Localizes at sites where active actin remodeling takes place, such as lamellipodia and membrane ruffles. Different isoforms may have functional differences. Involved in the control of morphological and cytoskeletal changes associated with dendritic cell maturation. Involved in targeting ACTN to specific May be required for the initiation of neural tube closure.4 Publications

GO - Biological processi

  • actin cytoskeleton organization Source: MGI
  • cell migration Source: InterPro
  • epithelial cell morphogenesis Source: MGI
  • keratinocyte development Source: MGI
Complete GO annotation...

Keywords - Ligandi

Actin-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Palladin
Gene namesi
Name:Palld
Synonyms:Kiaa0992
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:1919583. Palld.

Subcellular locationi

  • Cytoplasmcytoskeleton 1 Publication
  • Cell junctionfocal adhesion 1 Publication
  • CytoplasmmyofibrilsarcomereZ line 1 Publication
  • Cell projectionruffle By similarity
  • Cell projectionpodosome By similarity
  • Cell projectionlamellipodium By similarity
  • Cell projectionaxon By similarity
  • Cell projectiongrowth cone By similarity

  • Note: Localizes to stress fibers and Z lines. Preferentially expressed in the excitatory presynaptic terminals.By similarity1 Publication

GO - Cellular componenti

  • actin cytoskeleton Source: MGI
  • actin filament Source: HGNC
  • axon Source: UniProtKB-SubCell
  • cytoplasm Source: MGI
  • focal adhesion Source: MGI
  • growth cone Source: UniProtKB-SubCell
  • lamellipodium Source: UniProtKB-SubCell
  • mitochondrion Source: MGI
  • nucleus Source: HGNC
  • plasma membrane Source: MGI
  • podosome Source: UniProtKB-SubCell
  • ruffle Source: UniProtKB-SubCell
  • Z disc Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Cytoskeleton

Pathology & Biotechi

Disruption phenotypei

Death around E15.5 due to severe neural tube closure defects and herniation of liver and intestine. Palld-deficient mouse embryonic fibroblasts display disorganized actin cytoskeleton, decreased polymerized filament actin, and decreased cell adhesion and compromised cell spreading on various extracellular matrix. Mice embryos lacking Palld exhibit defects in erythropoiesis.3 Publications

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003027211 – 1408PalladinAdd BLAST1408

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei194PhosphoserineCombined sources1
Disulfide bondi299 ↔ 351PROSITE-ProRule annotation
Disulfide bondi469 ↔ 528PROSITE-ProRule annotation
Modified residuei639PhosphoserineCombined sources1
Modified residuei642PhosphothreonineCombined sources1
Modified residuei648PhosphoserineBy similarity1
Modified residuei700PhosphoserineBy similarity1
Modified residuei704PhosphoserineBy similarity1
Modified residuei744PhosphoserineBy similarity1
Modified residuei901PhosphoserineCombined sources1
Modified residuei1004PhosphoserineCombined sources1
Modified residuei1009PhosphoserineCombined sources1
Modified residuei1126PhosphoserineBy similarity1
Modified residuei1129PhosphoserineBy similarity1
Modified residuei1131PhosphoserineBy similarity1
Modified residuei1141PhosphoserineCombined sources1
Modified residuei1143Phosphoserine; by PKB/AKT1Combined sources1
Modified residuei1146PhosphoserineCombined sources1
Disulfide bondi1181 ↔ 1233PROSITE-ProRule annotation
Modified residuei1377PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylated predominantly on serines and, to a lesser extent, on tyrosines. Phosphorylation at Ser-1143 by PKB/AKT1 modulates cytoskeletal organization and cell motility (By similarity).By similarity

Keywords - PTMi

Disulfide bond, Phosphoprotein

Proteomic databases

PaxDbiQ9ET54.
PeptideAtlasiQ9ET54.
PRIDEiQ9ET54.

PTM databases

iPTMnetiQ9ET54.
PhosphoSitePlusiQ9ET54.

Expressioni

Tissue specificityi

Detected in both muscle and non-muscle tissues and cells (at protein level). Isoform 3 is widely expressed, isoform 4 is particularly abundant in tissues rich in smooth muscle and in the cardiac muscle and isoform 1 is detected in heart.2 Publications

Developmental stagei

Ubiquitously detected in embryonic tissues, and down-regulated in certain adult tissues (at protein level). Isoform 3 is widely expressed in embryonic tissues (at protein level). In adults is detected in spleen and gut, and is almost undetectable in heart, skeletal muscle, liver, and kidney (at protein level). Isoform 4 is widely expressed in neonatal tissues (brain, heart, lung, stomach, intestine, kidney, bone and skin) (at protein level). Late in development expression is restricted to cardiac muscle and to organs rich in smooth muscle (at protein level). Isoform 1 is detected in neonatal striated muscle and bone, and remains highly expressed in adult skeletal and cardiac muscle (at protein level). Adult brain express an isoform of 80-85 kDa. At E8.5 is mainly expressed the rostral and caudal part of neural plate. No expression is detected in somite. At E9.5 and E10.5 is ubiquitously detected.2 Publications

Gene expression databases

BgeeiENSMUSG00000058056.
CleanExiMM_PALLD.
ExpressionAtlasiQ9ET54. baseline and differential.
GenevisibleiQ9ET54. MM.

Interactioni

Subunit structurei

Interacts with ACTN, ARGBP2, LPP, PFN1, SPIN90, SRC and EZR (By similarity). Interacts with EPS8, LASP1 and VASP.By similarity3 Publications

Protein-protein interaction databases

BioGridi215316. 1 interactor.
IntActiQ9ET54. 4 interactors.
MINTiMINT-4129416.
STRINGi10090.ENSMUSP00000034057.

Structurei

Secondary structure

11408
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi1035 – 1038Combined sources4
Beta strandi1043 – 1048Combined sources6
Beta strandi1058 – 1061Combined sources4
Beta strandi1071 – 1077Combined sources7
Beta strandi1081 – 1089Combined sources9
Turni1092 – 1094Combined sources3
Beta strandi1096 – 1101Combined sources6
Beta strandi1114 – 1118Combined sources5

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2LQRNMR-A1022-1126[»]
ProteinModelPortaliQ9ET54.
SMRiQ9ET54.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini278 – 367Ig-like C2-type 1Add BLAST90
Domaini448 – 546Ig-like C2-type 2Add BLAST99
Domaini1026 – 1110Ig-like C2-type 3Add BLAST85
Domaini1160 – 1251Ig-like C2-type 4Add BLAST92
Domaini1259 – 1349Ig-like C2-type 5Add BLAST91

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni569 – 573Interaction with VASP1 Publication5
Regioni653 – 683Interaction with LASP1Add BLAST31
Regioni683 – 713Interaction with ARGBP2, SPIN90 and SRCBy similarityAdd BLAST31
Regioni782 – 842Interaction with EPS81 PublicationAdd BLAST61
Regioni807 – 842Interaction with ARGBP2, SPIN90, SRC and PFN1By similarityAdd BLAST36
Regioni830 – 834Interaction with VASP1 Publication5
Regioni1162 – 1251Interaction with EZRBy similarityAdd BLAST90
Regioni1261 – 1351Interaction with EZRBy similarityAdd BLAST91

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi570 – 574Poly-Pro5
Compositional biasi640 – 872Pro-richAdd BLAST233

Sequence similaritiesi

Belongs to the myotilin/palladin family.Curated

Keywords - Domaini

Immunoglobulin domain, Repeat

Phylogenomic databases

eggNOGiENOG410IGH0. Eukaryota.
ENOG41103YT. LUCA.
GeneTreeiENSGT00840000129779.
HOGENOMiHOG000028074.
HOVERGENiHBG059166.
InParanoidiQ9ET54.
OMAiTPRVRWF.
OrthoDBiEOG091G011D.
PhylomeDBiQ9ET54.
TreeFamiTF343193.

Family and domain databases

Gene3Di2.60.40.10. 6 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR033017. Palladin.
[Graphical view]
PANTHERiPTHR10489:SF741. PTHR10489:SF741. 3 hits.
PfamiPF07679. I-set. 5 hits.
[Graphical view]
SMARTiSM00409. IG. 5 hits.
SM00408. IGc2. 5 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 5 hits.
PROSITEiPS50835. IG_LIKE. 5 hits.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ET54-1) [UniParc]FASTAAdd to basket
Also known as: 200 kDa isoform

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSETSSHDSF YDSLSDVQEE GKSADFFPGL SAFLSQEEIN KSLDLARRAI
60 70 80 90 100
DSSETEDFDS EKEISQIFSK SPISLCETPS HEEPKSGKQT SSERPQDSRR
110 120 130 140 150
APVQPLTGDQ AERITSPGSK RKPGVSPLLA SPSYIRSLRK AEKRGAKNPN
160 170 180 190 200
PSSKPKTAQQ SKAGPQSQLC DKAASFIEEL TSIFREAAKP RNRSPNGESS
210 220 230 240 250
SPDSGYLSPK NQPSALMSAS ASQSPTADQL DQLEMDAEVK QAQGSLCYQA
260 270 280 290 300
HQASEETLPL AHIPHPQPQK ARHLPTAPRF IQKLRSQEVA EGSRVYLECR
310 320 330 340 350
VTGNPTPRVR WFCEGKELYN SPDVQIHCES GELHTLVIAE AFEDDTGRYT
360 370 380 390 400
CLATNPSGSD STSAEVFIEG ASSTDSDSES LSFISKAGAM PQAQKKTTSV
410 420 430 440 450
SLTIGSSAPK TGVTTAVIQP LSVPVQQAHS ATSYLCRPDG TTMGCLLPVF
460 470 480 490 500
TKELQNTAAS EGQVVVLECR VRGAPPLQVQ WFRQGSEIQD SPDFRILQKK
510 520 530 540 550
PRSTAEPEEI CTLVIAESFP EDAGIFTCSA TNDYGSVTST AQLVITSANN
560 570 580 590 600
ENCSYDSTGE PNSDHFQHFP PPPPILETGS YELASQKPSE IQQVNSPNLG
610 620 630 640 650
FSMAALQMQF NTAERETNGV HPSHGVNGLI NGKAYGNKSP PTPTALLSPT
660 670 680 690 700
KEPPPLLAKP KLDPLKLQQL QNQVRLEQEA CAWPPAPPGV PCNSSSSGSS
710 720 730 740 750
APPSPPFPPP PPAFPELAAC ASPVPSEPMS ALASRATAMQ SSGSFNYARP
760 770 780 790 800
KQFIAAQNLG PASGLPTPTS SPSSSSLPSP LSPTPRPFGR APGPPFVEPE
810 820 830 840 850
AMWGPSSPSP PPPPPPVFSP SAAYPVPDVF PLPPPPPPLP SSTSHCASPA
860 870 880 890 900
RFGPSQTPAA FLSALLPSQP PPVAVNALGL PKGVTPAGFP KKSSRTARIA
910 920 930 940 950
SDEEIQGTKD AVIQDLERKL RFKEDLLNNG QPRLTYEERM ARRLLGADSA
960 970 980 990 1000
NVFNIQEPEE TAANQDAGAP RASVGGPLDG QKEYKVSSCE QRLISEIEYR
1010 1020 1030 1040 1050
LERSPVDESG DEVQDPDVPV ENATAPFFEM KLKHYKIFEG MPVTFTCRVA
1060 1070 1080 1090 1100
GNPKPKIYWF KDGKQISPKS DHYTIQRDLD GTCSLHTTAS TLDDDGNYTI
1110 1120 1130 1140 1150
MAANPQGRVS CTGRLMVQAV NQRGRSPRSP SGHPHARRPR SRSRDSGDEN
1160 1170 1180 1190 1200
EPIQERFFRP HFLQAPGDLT VQEGKLCRMD CKVSGLPTPD LSWQLDGKPI
1210 1220 1230 1240 1250
RPDSAHKMLV RENGVHSLII EPVTSRDAGI YTCIATNRAG QNSFNLELVV
1260 1270 1280 1290 1300
AAKEAHKAPV FMEKLQNTGV ADGYPVRLEC RVSGVPPPQI FWKKENESLT
1310 1320 1330 1340 1350
HSTERVSMHQ DNHGYICLLI QGATKEDAGW YTVSAKNEAG IVSCTARLDV
1360 1370 1380 1390 1400
YTQWHQQPQT TKPKKVRPSA SRYAALSDQG LDIKAAFQPE ASPSHLTLNS

GLVESEDL
Length:1,408
Mass (Da):152,131
Last modified:September 11, 2007 - v2
Checksum:i5BCF647C110619C9
GO
Isoform 2 (identifier: Q9ET54-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     663-887: Missing.
     966-982: Missing.
     1352-1408: TQWHQQPQTTKPKKVRPSASRYAALSDQGLDIKAAFQPEASPSHLTLNSGLVESEDL → ISRH

Show »
Length:1,113
Mass (Da):122,090
Checksum:i2E4249532BDEACEB
GO
Isoform 3 (identifier: Q9ET54-3) [UniParc]FASTAAdd to basket
Also known as: 90 kDa isoform, 3Ig isoform

The sequence of this isoform differs from the canonical sequence as follows:
     1-728: Missing.
     966-982: Missing.

Show »
Length:663
Mass (Da):72,368
Checksum:i87C70C4EDC263B5E
GO
Isoform 4 (identifier: Q9ET54-4) [UniParc]FASTAAdd to basket
Also known as: 140 kDa isoform, 4Ig isoform

The sequence of this isoform differs from the canonical sequence as follows:
     1-389: Missing.
     966-982: Missing.

Show »
Length:1,002
Mass (Da):108,287
Checksum:i5E630ABBBF42CB74
GO
Isoform 5 (identifier: Q9ET54-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-738: Missing.

Note: No experimental confirmation available.
Show »
Length:670
Mass (Da):72,985
Checksum:iCCF8E48D7ADEDDD6
GO
Isoform 6 (identifier: Q9ET54-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     966-982: Missing.

Note: No experimental confirmation available.
Show »
Length:1,391
Mass (Da):150,553
Checksum:iFF63541E07E7E676
GO

Sequence cautioni

The sequence AK031696 differs from that shown. Reason: Frameshift at position 821.Curated
The sequence BAB26871 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1022N → K in AK031696 (PubMed:16141072).Curated1
Sequence conflicti1053P → T in AK031696 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0279311 – 738Missing in isoform 5. 1 PublicationAdd BLAST738
Alternative sequenceiVSP_0279321 – 728Missing in isoform 3. CuratedAdd BLAST728
Alternative sequenceiVSP_0279331 – 389Missing in isoform 4. CuratedAdd BLAST389
Alternative sequenceiVSP_027934663 – 887Missing in isoform 2. CuratedAdd BLAST225
Alternative sequenceiVSP_027935966 – 982Missing in isoform 2, isoform 3, isoform 4 and isoform 6. 3 PublicationsAdd BLAST17
Alternative sequenceiVSP_0279361352 – 1408TQWHQ…ESEDL → ISRH in isoform 2. CuratedAdd BLAST57

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC121881 Genomic DNA. No translation available.
AC139846 Genomic DNA. No translation available.
AC147616 Genomic DNA. No translation available.
BC076588 mRNA. Translation: AAH76588.1.
BC127081 mRNA. Translation: AAI27082.1.
AK173081 mRNA. Translation: BAD32359.1.
AF205078 mRNA. Translation: AAG00078.1.
AK010350 mRNA. Translation: BAB26871.1. Different initiation.
AK031696 mRNA. No translation available.
CCDSiCCDS40350.1. [Q9ET54-2]
CCDS80880.1. [Q9ET54-3]
CCDS80881.1. [Q9ET54-4]
CCDS80882.1. [Q9ET54-1]
RefSeqiNP_001074859.1. NM_001081390.1. [Q9ET54-2]
NP_001280701.1. NM_001293772.1. [Q9ET54-1]
NP_001280703.1. NM_001293774.1. [Q9ET54-3]
XP_006509566.1. XM_006509503.2. [Q9ET54-6]
XP_011240544.1. XM_011242242.2. [Q9ET54-1]
UniGeneiMm.29933.
Mm.458226.
Mm.487581.

Genome annotation databases

EnsembliENSMUST00000034057; ENSMUSP00000034057; ENSMUSG00000058056. [Q9ET54-2]
ENSMUST00000121200; ENSMUSP00000112374; ENSMUSG00000058056. [Q9ET54-3]
ENSMUST00000121493; ENSMUSP00000113874; ENSMUSG00000058056. [Q9ET54-4]
ENSMUST00000121785; ENSMUSP00000112442; ENSMUSG00000058056. [Q9ET54-1]
GeneIDi72333.
KEGGimmu:72333.
UCSCiuc009lud.3. mouse. [Q9ET54-3]
uc009lue.3. mouse. [Q9ET54-4]
uc009luf.3. mouse. [Q9ET54-1]
uc009lug.3. mouse. [Q9ET54-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC121881 Genomic DNA. No translation available.
AC139846 Genomic DNA. No translation available.
AC147616 Genomic DNA. No translation available.
BC076588 mRNA. Translation: AAH76588.1.
BC127081 mRNA. Translation: AAI27082.1.
AK173081 mRNA. Translation: BAD32359.1.
AF205078 mRNA. Translation: AAG00078.1.
AK010350 mRNA. Translation: BAB26871.1. Different initiation.
AK031696 mRNA. No translation available.
CCDSiCCDS40350.1. [Q9ET54-2]
CCDS80880.1. [Q9ET54-3]
CCDS80881.1. [Q9ET54-4]
CCDS80882.1. [Q9ET54-1]
RefSeqiNP_001074859.1. NM_001081390.1. [Q9ET54-2]
NP_001280701.1. NM_001293772.1. [Q9ET54-1]
NP_001280703.1. NM_001293774.1. [Q9ET54-3]
XP_006509566.1. XM_006509503.2. [Q9ET54-6]
XP_011240544.1. XM_011242242.2. [Q9ET54-1]
UniGeneiMm.29933.
Mm.458226.
Mm.487581.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2LQRNMR-A1022-1126[»]
ProteinModelPortaliQ9ET54.
SMRiQ9ET54.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi215316. 1 interactor.
IntActiQ9ET54. 4 interactors.
MINTiMINT-4129416.
STRINGi10090.ENSMUSP00000034057.

PTM databases

iPTMnetiQ9ET54.
PhosphoSitePlusiQ9ET54.

Proteomic databases

PaxDbiQ9ET54.
PeptideAtlasiQ9ET54.
PRIDEiQ9ET54.

Protocols and materials databases

DNASUi72333.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000034057; ENSMUSP00000034057; ENSMUSG00000058056. [Q9ET54-2]
ENSMUST00000121200; ENSMUSP00000112374; ENSMUSG00000058056. [Q9ET54-3]
ENSMUST00000121493; ENSMUSP00000113874; ENSMUSG00000058056. [Q9ET54-4]
ENSMUST00000121785; ENSMUSP00000112442; ENSMUSG00000058056. [Q9ET54-1]
GeneIDi72333.
KEGGimmu:72333.
UCSCiuc009lud.3. mouse. [Q9ET54-3]
uc009lue.3. mouse. [Q9ET54-4]
uc009luf.3. mouse. [Q9ET54-1]
uc009lug.3. mouse. [Q9ET54-2]

Organism-specific databases

CTDi23022.
MGIiMGI:1919583. Palld.
RougeiSearch...

Phylogenomic databases

eggNOGiENOG410IGH0. Eukaryota.
ENOG41103YT. LUCA.
GeneTreeiENSGT00840000129779.
HOGENOMiHOG000028074.
HOVERGENiHBG059166.
InParanoidiQ9ET54.
OMAiTPRVRWF.
OrthoDBiEOG091G011D.
PhylomeDBiQ9ET54.
TreeFamiTF343193.

Miscellaneous databases

ChiTaRSiPalld. mouse.
PROiQ9ET54.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000058056.
CleanExiMM_PALLD.
ExpressionAtlasiQ9ET54. baseline and differential.
GenevisibleiQ9ET54. MM.

Family and domain databases

Gene3Di2.60.40.10. 6 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR033017. Palladin.
[Graphical view]
PANTHERiPTHR10489:SF741. PTHR10489:SF741. 3 hits.
PfamiPF07679. I-set. 5 hits.
[Graphical view]
SMARTiSM00409. IG. 5 hits.
SM00408. IGc2. 5 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 5 hits.
PROSITEiPS50835. IG_LIKE. 5 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPALLD_MOUSE
AccessioniPrimary (citable) accession number: Q9ET54
Secondary accession number(s): A0JNZ3
, Q69ZT7, Q6DFX7, Q9CWW1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 11, 2007
Last modified: November 2, 2016
This is version 129 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.