Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Espin

Gene

Espn

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Multifunctional actin-bundling protein. Plays a major role in regulating the organization, dimensions, dynamics and signaling capacities of the actin filament-rich, microvillus-type specializations that mediate sensory transduction in variouS mechanosensory and chemosensory cells.2 Publications

GO - Molecular functioni

GO - Biological processi

  • actin filament bundle assembly Source: MGI
  • actin filament network formation Source: UniProtKB
  • locomotory behavior Source: MGI
  • negative regulation of cytoskeleton organization Source: UniProtKB
  • parallel actin filament bundle assembly Source: MGI
  • positive regulation of filopodium assembly Source: MGI
  • sensory perception of sound Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Hearing

Keywords - Ligandi

Actin-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Espin
Alternative name(s):
Ectoplasmic specialization protein
Gene namesi
Name:Espn
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:1861630. Espn.

Subcellular locationi

Isoform 8 :
  • Cytoplasmcytoskeleton
  • Cell junction

  • Note: Isoform 8 localizes to parallel actin bundles of ectoplasmic specializations between neighboring Sertoli cells and at sites where Sertoli cells contact the heads of elongate spermatids.

GO - Cellular componenti

  • actin cytoskeleton Source: MGI
  • brush border Source: UniProtKB
  • cell junction Source: UniProtKB-SubCell
  • cytoplasm Source: MGI
  • dendritic spine Source: UniProtKB-SubCell
  • filamentous actin Source: UniProtKB
  • microvillus Source: MGI
  • stereocilium bundle Source: MGI
  • stereocilium tip Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Cytoskeleton

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003346671 – 871EspinAdd BLAST871

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei338PhosphoserineBy similarity1
Modified residuei342PhosphoserineCombined sources1
Modified residuei517PhosphoserineBy similarity1
Modified residuei524PhosphoserineBy similarity1
Modified residuei556PhosphoserineBy similarity1
Modified residuei665PhosphoserineCombined sources1
Modified residuei704PhosphoserineCombined sources1
Modified residuei708PhosphoserineCombined sources1
Modified residuei714PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9ET47.
PRIDEiQ9ET47.

PTM databases

iPTMnetiQ9ET47.
PhosphoSitePlusiQ9ET47.

Expressioni

Tissue specificityi

Expressed at high concentration in the microvillar parallel actin bundle (PAB) of hair cells stereocilia in the cochlea and vestibular system. Detected also at high levels of a number of other sensory cell types, including taste receptor cells, solitary chemoreceptor cells, vomeronasal sensory neurons and Merkel cells. Isoforms 2, 3, 4 and 5 are expressed in Purkinje cells dentritic spines.3 Publications

Gene expression databases

BgeeiENSMUSG00000028943.
ExpressionAtlasiQ9ET47. baseline and differential.
GenevisibleiQ9ET47. MM.

Interactioni

Subunit structurei

Monomer. Binds F-actin in a Ca2+-resistant fashion. Interacts (via N-terminal) with BAIAP2 (via SH3-domain). Interacts with PFN2.3 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi207859. 8 interactors.
IntActiQ9ET47. 9 interactors.
MINTiMINT-258237.
STRINGi10090.ENSMUSP00000030785.

Structurei

Secondary structure

1871
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi1 – 12Combined sources12
Helixi15 – 23Combined sources9
Helixi39 – 44Combined sources6
Turni45 – 47Combined sources3
Helixi49 – 57Combined sources9
Helixi73 – 80Combined sources8
Helixi83 – 90Combined sources8
Turni91 – 93Combined sources3
Helixi107 – 113Combined sources7
Helixi117 – 125Combined sources9
Helixi141 – 148Combined sources8
Helixi151 – 160Combined sources10
Helixi162 – 164Combined sources3
Helixi175 – 181Combined sources7
Helixi185 – 195Combined sources11
Helixi209 – 215Combined sources7
Helixi219 – 228Combined sources10
Helixi243 – 249Combined sources7
Helixi253 – 261Combined sources9
Helixi275 – 281Combined sources7
Helixi285 – 293Combined sources9
Helixi308 – 314Combined sources7
Helixi318 – 329Combined sources12

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5ET0X-ray2.30A/C1-352[»]
5ET1X-ray1.65A/B1-352[»]
ProteinModelPortaliQ9ET47.
SMRiQ9ET47.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati1 – 31ANK 1Add BLAST31
Repeati35 – 66ANK 2Add BLAST32
Repeati69 – 99ANK 3Add BLAST31
Repeati103 – 132ANK 4Add BLAST30
Repeati137 – 167ANK 5Add BLAST31
Repeati171 – 201ANK 6Add BLAST31
Repeati205 – 235ANK 7Add BLAST31
Repeati239 – 268ANK 8Add BLAST30
Repeati271 – 300ANK 9Add BLAST30
Domaini669 – 686WH2PROSITE-ProRule annotationAdd BLAST18

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili772 – 848Sequence analysisAdd BLAST77

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi428 – 465Pro-richAdd BLAST38
Compositional biasi607 – 629Pro-richAdd BLAST23
Compositional biasi642 – 645Poly-Ser4

Domaini

The WH2-domain binds actin monomer and mediates actin bundle assembly.

Sequence similaritiesi

Contains 9 ANK repeats.PROSITE-ProRule annotation
Contains 1 WH2 domain.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Coiled coil, Repeat

Phylogenomic databases

eggNOGiKOG0504. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00600000084407.
HOVERGENiHBG100662.
InParanoidiQ9ET47.
PhylomeDBiQ9ET47.
TreeFamiTF326392.

Family and domain databases

Gene3Di1.25.40.20. 1 hit.
3.90.810.10. 1 hit.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR000095. CRIB_dom.
IPR030233. Espn.
IPR003124. WH2_dom.
[Graphical view]
PANTHERiPTHR24153:SF14. PTHR24153:SF14. 2 hits.
PfamiPF12796. Ank_2. 2 hits.
PF02205. WH2. 1 hit.
[Graphical view]
SMARTiSM00248. ANK. 9 hits.
SM00246. WH2. 1 hit.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 6 hits.
PS51082. WH2. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ET47-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALEQALQAA RRGDLDVLRS LHAAGLLGPS LRDSLDALPV HHAARSGKLH
60 70 80 90 100
CLRYLVEEVA LPAVSRARNG ATPAHDAAAT GYLSCLQWLL TQGGCRVQEK
110 120 130 140 150
DNSGATVLHL AARFGHPDVV KWLLYQGGAN SAITTDTGAL PIHYAAAKGD
160 170 180 190 200
LPSLKLLVGH YPEGVNAQTN NGATPLYLAC QEGHLEVTKY LVQECSADPH
210 220 230 240 250
LRAQDGMTPL HAAAQMGHNP VLVWLVSFAD VSFSEQDHDG ATAMHFAASR
260 270 280 290 300
GHTKVLSWLL LHGAEISQDL WGGTPLHDAA ENGELECCQI LAVNGAGLDV
310 320 330 340 350
RDHDGYTAAD LAEFNGHTHC SRYLRTVQTL SLEHRVLSRD QSMDLEAKQL
360 370 380 390 400
DSGMSSPNTT MSVQPMTFDL GSPTSTFSNY DSCSSSHSSS KGQRSNRGIP
410 420 430 440 450
GARAADLQSY MDMLNPEKSL PRGKLGKPSP PPPPPPPPPS FPPPPPPTGT
460 470 480 490 500
QPPPPPPGYP APNPPVGLHL NNIYMQTKNK LRHVEVDSLK EPKVELNDQF
510 520 530 540 550
AQPSSGDGHS GLHRQDSGLL RQDSELLHRQ ELLRHSTGLR RQDSDRKQRS
560 570 580 590 600
FSKQPSTGDY YRQLGRSPGE PLAARPGMAH SEEAALLPGN HVHNGCSADS
610 620 630 640 650
KASRELPPPP PPPPLPEALS SPPPAPPLPI EGAGAACGQR RSSSSTGKVR
660 670 680 690 700
VLRHRKSTKS FNMMSPTGDN SELLAEIKAG KSLKPTPQSK GLTTVFSGSG
710 720 730 740 750
QPASQPESPQ PLVSPAPSRT RSPTPPASGS QPLLNGSVVP APPATPAPGV
760 770 780 790 800
HLDVEALIPT LDEQGRPIPE WKRQVMVRKL QQKMQEEEEQ RRKEEEEEAR
810 820 830 840 850
LASLPAWRRD ILRKKLEEER EQKRKEEERQ KLEEIQRAKE QSEKLRTLGY
860 870
DEAKLAPWQR QVILKKGEIP K
Length:871
Mass (Da):94,497
Last modified:May 20, 2008 - v2
Checksum:iC7707D5C73678DA1
GO
Isoform 2 (identifier: Q9ET47-2) [UniParc]FASTAAdd to basket
Also known as: Purkinje cell espin isoform 1

The sequence of this isoform differs from the canonical sequence as follows:
     1-327: Missing.
     328-330: QTL → MGN
     492-502: Missing.
     648-656: Missing.

Show »
Length:524
Mass (Da):57,110
Checksum:i1E8E73310C9FF73A
GO
Isoform 3 (identifier: Q9ET47-3) [UniParc]FASTAAdd to basket
Also known as: Purkinje cell espin isoform 1+

The sequence of this isoform differs from the canonical sequence as follows:
     1-327: Missing.
     328-330: QTL → MGN
     492-502: Missing.

Show »
Length:533
Mass (Da):58,284
Checksum:iB6C766CA2E809B12
GO
Isoform 4 (identifier: Q9ET47-4) [UniParc]FASTAAdd to basket
Also known as: Purkinje cell espin isoform 2+

The sequence of this isoform differs from the canonical sequence as follows:
     1-327: Missing.
     328-330: QTL → MGN
     492-583: Missing.

Show »
Length:452
Mass (Da):49,195
Checksum:i6BF7A17610ADB308
GO
Isoform 5 (identifier: Q9ET47-5) [UniParc]FASTAAdd to basket
Also known as: Purkinje cell espin isoform 2

The sequence of this isoform differs from the canonical sequence as follows:
     1-327: Missing.
     328-330: QTL → MGN
     492-583: Missing.
     648-656: Missing.

Show »
Length:443
Mass (Da):48,021
Checksum:iC1E65EA9DF270594
GO
Isoform 6 (identifier: Q9ET47-6) [UniParc]FASTAAdd to basket
Also known as: 3B

The sequence of this isoform differs from the canonical sequence as follows:
     1-547: Missing.
     548-583: QRSFSKQPSTGDYYRQLGRSPGEPLAARPGMAHSEE → MAHSEEVRVHQPALAGCSGPSPVPRPSLSGPSAPPQ
     648-656: Missing.

Show »
Length:315
Mass (Da):34,039
Checksum:i881DAD36A6CC0FCF
GO
Isoform 7 (identifier: Q9ET47-7) [UniParc]FASTAAdd to basket
Also known as: 3A

The sequence of this isoform differs from the canonical sequence as follows:
     1-577: Missing.
     648-656: Missing.

Show »
Length:285
Mass (Da):31,109
Checksum:i8F41844768B6884D
GO
Isoform 8 (identifier: Q9ET47-8) [UniParc]FASTAAdd to basket
Also known as: small

The sequence of this isoform differs from the canonical sequence as follows:
     1-643: Missing.
     644-656: SSTGKVRVLRHRK → MNSQGPLGGGRIP
     705-705: Q → QVGTGRVPRPGSQCLPSAQPYCFSRQ

Show »
Length:253
Mass (Da):28,116
Checksum:iC7AE5E342801385C
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti564L → M in AAO50326 (PubMed:12598619).Curated1
Sequence conflicti564L → M in AAO50327 (PubMed:12598619).Curated1
Sequence conflicti564L → M in AAF98134 (PubMed:10975527).Curated1
Sequence conflicti720T → A in AAF18322 (PubMed:10588661).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0337301 – 643Missing in isoform 8. CuratedAdd BLAST643
Alternative sequenceiVSP_0337311 – 577Missing in isoform 7. 1 PublicationAdd BLAST577
Alternative sequenceiVSP_0337321 – 547Missing in isoform 6. 1 PublicationAdd BLAST547
Alternative sequenceiVSP_0337331 – 327Missing in isoform 2, isoform 4, isoform 3 and isoform 5. 1 PublicationAdd BLAST327
Alternative sequenceiVSP_033734328 – 330QTL → MGN in isoform 2, isoform 4, isoform 3 and isoform 5. 1 Publication3
Alternative sequenceiVSP_033735492 – 583Missing in isoform 4 and isoform 5. 1 PublicationAdd BLAST92
Alternative sequenceiVSP_033736492 – 502Missing in isoform 2 and isoform 3. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_033737548 – 583QRSFS…AHSEE → MAHSEEVRVHQPALAGCSGP SPVPRPSLSGPSAPPQ in isoform 6. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_033738644 – 656SSTGK…LRHRK → MNSQGPLGGGRIP in isoform 8. CuratedAdd BLAST13
Alternative sequenceiVSP_033739648 – 656Missing in isoform 2, isoform 5, isoform 6 and isoform 7. 2 Publications9
Alternative sequenceiVSP_033740705Q → QVGTGRVPRPGSQCLPSAQP YCFSRQ in isoform 8. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF239886 mRNA. Translation: AAF98134.1.
AF540942 mRNA. Translation: AAO50326.1.
AF540943 mRNA. Translation: AAO50327.1.
AF540944 mRNA. Translation: AAO50328.1.
AF540945 mRNA. Translation: AAO50329.1.
AY587570 mRNA. Translation: AAT46472.1.
AY587571 mRNA. Translation: AAT46473.1.
AF134858 Genomic DNA. Translation: AAF18322.1.
AL772240 Genomic DNA. Translation: CAM19680.1.
AL772240 Genomic DNA. Translation: CAM19684.1.
AL772240 Genomic DNA. Translation: CAM19685.1.
AL772240 Genomic DNA. Translation: CAM19686.1.
AL772240 Genomic DNA. Translation: CAM19687.1.
AL772240 Genomic DNA. Translation: CAM19691.1.
CCDSiCCDS18989.1. [Q9ET47-1]
CCDS18990.1. [Q9ET47-3]
CCDS18991.1. [Q9ET47-4]
CCDS18992.1. [Q9ET47-5]
CCDS18993.1. [Q9ET47-2]
CCDS18994.1. [Q9ET47-8]
RefSeqiNP_997570.1. NM_207687.2. [Q9ET47-1]
NP_997571.1. NM_207688.2. [Q9ET47-3]
NP_997572.1. NM_207689.2. [Q9ET47-4]
NP_997573.1. NM_207690.2. [Q9ET47-5]
NP_997574.2. NM_207691.2. [Q9ET47-2]
UniGeneiMm.264215.

Genome annotation databases

EnsembliENSMUST00000030785; ENSMUSP00000030785; ENSMUSG00000028943. [Q9ET47-1]
ENSMUST00000070018; ENSMUSP00000065545; ENSMUSG00000028943. [Q9ET47-2]
ENSMUST00000080042; ENSMUSP00000078951; ENSMUSG00000028943. [Q9ET47-4]
ENSMUST00000084114; ENSMUSP00000081131; ENSMUSG00000028943. [Q9ET47-3]
ENSMUST00000105653; ENSMUSP00000101278; ENSMUSG00000028943. [Q9ET47-7]
ENSMUST00000105657; ENSMUSP00000101282; ENSMUSG00000028943. [Q9ET47-5]
GeneIDi56226.
KEGGimmu:56226.
UCSCiuc008vzn.1. mouse. [Q9ET47-6]
uc008vzo.1. mouse. [Q9ET47-7]
uc008vzp.1. mouse. [Q9ET47-4]
uc008vzq.1. mouse. [Q9ET47-3]
uc008vzr.1. mouse. [Q9ET47-5]
uc008vzs.1. mouse. [Q9ET47-2]
uc008vzt.1. mouse. [Q9ET47-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF239886 mRNA. Translation: AAF98134.1.
AF540942 mRNA. Translation: AAO50326.1.
AF540943 mRNA. Translation: AAO50327.1.
AF540944 mRNA. Translation: AAO50328.1.
AF540945 mRNA. Translation: AAO50329.1.
AY587570 mRNA. Translation: AAT46472.1.
AY587571 mRNA. Translation: AAT46473.1.
AF134858 Genomic DNA. Translation: AAF18322.1.
AL772240 Genomic DNA. Translation: CAM19680.1.
AL772240 Genomic DNA. Translation: CAM19684.1.
AL772240 Genomic DNA. Translation: CAM19685.1.
AL772240 Genomic DNA. Translation: CAM19686.1.
AL772240 Genomic DNA. Translation: CAM19687.1.
AL772240 Genomic DNA. Translation: CAM19691.1.
CCDSiCCDS18989.1. [Q9ET47-1]
CCDS18990.1. [Q9ET47-3]
CCDS18991.1. [Q9ET47-4]
CCDS18992.1. [Q9ET47-5]
CCDS18993.1. [Q9ET47-2]
CCDS18994.1. [Q9ET47-8]
RefSeqiNP_997570.1. NM_207687.2. [Q9ET47-1]
NP_997571.1. NM_207688.2. [Q9ET47-3]
NP_997572.1. NM_207689.2. [Q9ET47-4]
NP_997573.1. NM_207690.2. [Q9ET47-5]
NP_997574.2. NM_207691.2. [Q9ET47-2]
UniGeneiMm.264215.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5ET0X-ray2.30A/C1-352[»]
5ET1X-ray1.65A/B1-352[»]
ProteinModelPortaliQ9ET47.
SMRiQ9ET47.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi207859. 8 interactors.
IntActiQ9ET47. 9 interactors.
MINTiMINT-258237.
STRINGi10090.ENSMUSP00000030785.

PTM databases

iPTMnetiQ9ET47.
PhosphoSitePlusiQ9ET47.

Proteomic databases

PaxDbiQ9ET47.
PRIDEiQ9ET47.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000030785; ENSMUSP00000030785; ENSMUSG00000028943. [Q9ET47-1]
ENSMUST00000070018; ENSMUSP00000065545; ENSMUSG00000028943. [Q9ET47-2]
ENSMUST00000080042; ENSMUSP00000078951; ENSMUSG00000028943. [Q9ET47-4]
ENSMUST00000084114; ENSMUSP00000081131; ENSMUSG00000028943. [Q9ET47-3]
ENSMUST00000105653; ENSMUSP00000101278; ENSMUSG00000028943. [Q9ET47-7]
ENSMUST00000105657; ENSMUSP00000101282; ENSMUSG00000028943. [Q9ET47-5]
GeneIDi56226.
KEGGimmu:56226.
UCSCiuc008vzn.1. mouse. [Q9ET47-6]
uc008vzo.1. mouse. [Q9ET47-7]
uc008vzp.1. mouse. [Q9ET47-4]
uc008vzq.1. mouse. [Q9ET47-3]
uc008vzr.1. mouse. [Q9ET47-5]
uc008vzs.1. mouse. [Q9ET47-2]
uc008vzt.1. mouse. [Q9ET47-1]

Organism-specific databases

CTDi83715.
MGIiMGI:1861630. Espn.

Phylogenomic databases

eggNOGiKOG0504. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00600000084407.
HOVERGENiHBG100662.
InParanoidiQ9ET47.
PhylomeDBiQ9ET47.
TreeFamiTF326392.

Miscellaneous databases

PROiQ9ET47.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000028943.
ExpressionAtlasiQ9ET47. baseline and differential.
GenevisibleiQ9ET47. MM.

Family and domain databases

Gene3Di1.25.40.20. 1 hit.
3.90.810.10. 1 hit.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR000095. CRIB_dom.
IPR030233. Espn.
IPR003124. WH2_dom.
[Graphical view]
PANTHERiPTHR24153:SF14. PTHR24153:SF14. 2 hits.
PfamiPF12796. Ank_2. 2 hits.
PF02205. WH2. 1 hit.
[Graphical view]
SMARTiSM00248. ANK. 9 hits.
SM00246. WH2. 1 hit.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 6 hits.
PS51082. WH2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiESPN_MOUSE
AccessioniPrimary (citable) accession number: Q9ET47
Secondary accession number(s): A2AK06
, A2AK09, A2AK13, B1AWP3, B1AWP6, B1AWQ2, Q6GYS0, Q6GYS1, Q80ZC0, Q80ZC1, Q80ZC2, Q80ZC3, Q9QY27
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 20, 2008
Last modified: November 30, 2016
This is version 114 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Miscellaneous

Jerker mice has a frameshift mutation that affect the espin C-terminus. This mutation cause deafness, vestibular dysfunction and hair cell degeneration.

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.