Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Acidic leucine-rich nuclear phosphoprotein 32 family member B

Gene

Anp32b

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Multifunctional protein working as a cell cycle progression factor as well as a cell survival factor. Required for the progression from the G1 to the S phase. Anti-apoptotic protein which functions as a caspase-3 inhibitor. Has no phosphatase 2A (PP2A) inhibitor activity. Exhibits histone chaperone properties, stimulating core histones to assemble into a nucleosome (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

  • activation of cysteine-type endopeptidase activity involved in apoptotic process Source: Ensembl
  • G1/S transition of mitotic cell cycle Source: MGI
  • histone exchange Source: GO_Central
  • inner ear development Source: MGI
  • negative regulation of cell differentiation Source: Ensembl
  • nucleocytoplasmic transport Source: GO_Central
  • nucleosome assembly Source: GO_Central
  • palate development Source: MGI
  • positive regulation of protein export from nucleus Source: Ensembl
  • regulation of cysteine-type endopeptidase activity involved in apoptotic process Source: GO_Central
  • vasculature development Source: MGI
  • ventricular system development Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Chaperone

Names & Taxonomyi

Protein namesi
Recommended name:
Acidic leucine-rich nuclear phosphoprotein 32 family member B
Alternative name(s):
Proliferation-related acidic leucine-rich protein PAL31
Gene namesi
Name:Anp32b
Synonyms:Pal31
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:1914878. Anp32b.

Subcellular locationi

  • Nucleus

  • Note: Accumulates in the nuclei at the S phase.By similarity

GO - Cellular componenti

  • cytoplasm Source: Ensembl
  • extracellular exosome Source: Ensembl
  • nucleolus Source: Ensembl
  • nucleus Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002362521 – 272Acidic leucine-rich nuclear phosphoprotein 32 family member BAdd BLAST272

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei164PhosphoserineBy similarity1
Modified residuei171PhosphoserineBy similarity1
Modified residuei265PhosphothreonineCombined sources1

Post-translational modificationi

Some glutamate residues are glycylated by TTLL8. This modification occurs exclusively on glutamate residues and results in a glycine chain on the gamma-carboxyl group.

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9EST5.
PaxDbiQ9EST5.
PeptideAtlasiQ9EST5.
PRIDEiQ9EST5.
TopDownProteomicsiQ9EST5-1. [Q9EST5-1]

PTM databases

iPTMnetiQ9EST5.
PhosphoSitePlusiQ9EST5.

Expressioni

Gene expression databases

BgeeiENSMUSG00000028333.
CleanExiMM_ANP32B.
GenevisibleiQ9EST5. MM.

Interactioni

Subunit structurei

Monomer. Interacts with histones H3 and H4 (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi212319. 3 interactors.
IntActiQ9EST5. 2 interactors.
MINTiMINT-1869930.
STRINGi10090.ENSMUSP00000099990.

Structurei

3D structure databases

ProteinModelPortaliQ9EST5.
SMRiQ9EST5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati18 – 38LRR 1Add BLAST21
Repeati43 – 64LRR 2Add BLAST22
Repeati65 – 87LRR 3Add BLAST23
Repeati89 – 110LRR 4Add BLAST22
Domaini123 – 161LRRCTAdd BLAST39

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi146 – 272Asp/Glu-rich (highly acidic)Add BLAST127

Domaini

Histone binding is mediated by the concave surface of the LRR region.By similarity

Sequence similaritiesi

Belongs to the ANP32 family.Curated
Contains 4 LRR (leucine-rich) repeats.Curated
Contains 1 LRRCT domain.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiKOG2739. Eukaryota.
ENOG4111HZT. LUCA.
GeneTreeiENSGT00560000077130.
HOGENOMiHOG000007361.
HOVERGENiHBG053102.
InParanoidiQ9EST5.
KOiK18647.
OMAiFRTFEVL.
OrthoDBiEOG091G0R8Z.
PhylomeDBiQ9EST5.
TreeFamiTF317206.

Family and domain databases

Gene3Di3.80.10.10. 1 hit.
InterProiIPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR003603. U2A'_phosphoprotein32A_C.
[Graphical view]
SMARTiSM00446. LRRcap. 1 hit.
[Graphical view]
SUPFAMiSSF52058. SSF52058. 1 hit.
PROSITEiPS51450. LRR. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9EST5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDMKRRIHLE LRNRTPAAVR ELVLDNCKAM DGKIEGLTDE FVNLEFLSLI
60 70 80 90 100
SVGLFSVSDL PKLPKLKKLE LSENRIFGGL DRLAEELPSL THLNLSGNNL
110 120 130 140 150
KDISTLEPLK RLDCLKSLDL FGCEVTNRSD YRETVFRLLP QLSYLDGYDR
160 170 180 190 200
EDQEAPDSDV EVDSVEEAPD SDGEVDGVDK EEEDEEGEDE EEEEDEDGEE
210 220 230 240 250
EEDEDEEDED EDEDVEGEDD EDEVSGEEEE FGHDGEVDED EEDEDEDEDE
260 270
EEEESGKGEK RKRETDDEGE DD
Length:272
Mass (Da):31,079
Last modified:March 1, 2001 - v1
Checksum:iBC22DC591AA6BC15
GO
Isoform 2 (identifier: Q9EST5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-227: E → EVNTTVFFPICVKTK
     269-272: GEDD → EEEPKNSSRDIPPSSVSPLVIHHQAWGLRPNKIVNVVRFSCKTLAVS

Note: No experimental confirmation available.
Show »
Length:329
Mass (Da):37,447
Checksum:i7DDD33F69960CEE5
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_023520227E → EVNTTVFFPICVKTK in isoform 2. 1 Publication1
Alternative sequenceiVSP_023521269 – 272GEDD → EEEPKNSSRDIPPSSVSPLV IHHQAWGLRPNKIVNVVRFS CKTLAVS in isoform 2. 1 Publication4

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB025582 mRNA. Translation: BAB12436.1.
AK165807 mRNA. Translation: BAE38387.1.
AL683884 Genomic DNA. Translation: CAM13790.1.
BC003489 mRNA. Translation: AAH03489.1.
BC005628 mRNA. Translation: AAH05628.1.
BC093506 mRNA. Translation: AAH93506.1.
CCDSiCCDS18151.1. [Q9EST5-1]
RefSeqiNP_570959.1. NM_130889.3. [Q9EST5-1]
UniGeneiMm.263913.

Genome annotation databases

EnsembliENSMUST00000102926; ENSMUSP00000099990; ENSMUSG00000028333. [Q9EST5-1]
GeneIDi67628.
KEGGimmu:67628.
UCSCiuc008stt.1. mouse. [Q9EST5-1]
uc012dds.1. mouse. [Q9EST5-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB025582 mRNA. Translation: BAB12436.1.
AK165807 mRNA. Translation: BAE38387.1.
AL683884 Genomic DNA. Translation: CAM13790.1.
BC003489 mRNA. Translation: AAH03489.1.
BC005628 mRNA. Translation: AAH05628.1.
BC093506 mRNA. Translation: AAH93506.1.
CCDSiCCDS18151.1. [Q9EST5-1]
RefSeqiNP_570959.1. NM_130889.3. [Q9EST5-1]
UniGeneiMm.263913.

3D structure databases

ProteinModelPortaliQ9EST5.
SMRiQ9EST5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi212319. 3 interactors.
IntActiQ9EST5. 2 interactors.
MINTiMINT-1869930.
STRINGi10090.ENSMUSP00000099990.

PTM databases

iPTMnetiQ9EST5.
PhosphoSitePlusiQ9EST5.

Proteomic databases

EPDiQ9EST5.
PaxDbiQ9EST5.
PeptideAtlasiQ9EST5.
PRIDEiQ9EST5.
TopDownProteomicsiQ9EST5-1. [Q9EST5-1]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000102926; ENSMUSP00000099990; ENSMUSG00000028333. [Q9EST5-1]
GeneIDi67628.
KEGGimmu:67628.
UCSCiuc008stt.1. mouse. [Q9EST5-1]
uc012dds.1. mouse. [Q9EST5-2]

Organism-specific databases

CTDi10541.
MGIiMGI:1914878. Anp32b.

Phylogenomic databases

eggNOGiKOG2739. Eukaryota.
ENOG4111HZT. LUCA.
GeneTreeiENSGT00560000077130.
HOGENOMiHOG000007361.
HOVERGENiHBG053102.
InParanoidiQ9EST5.
KOiK18647.
OMAiFRTFEVL.
OrthoDBiEOG091G0R8Z.
PhylomeDBiQ9EST5.
TreeFamiTF317206.

Miscellaneous databases

PROiQ9EST5.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000028333.
CleanExiMM_ANP32B.
GenevisibleiQ9EST5. MM.

Family and domain databases

Gene3Di3.80.10.10. 1 hit.
InterProiIPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR003603. U2A'_phosphoprotein32A_C.
[Graphical view]
SMARTiSM00446. LRRcap. 1 hit.
[Graphical view]
SUPFAMiSSF52058. SSF52058. 1 hit.
PROSITEiPS51450. LRR. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiAN32B_MOUSE
AccessioniPrimary (citable) accession number: Q9EST5
Secondary accession number(s): B1AVH9, Q566J4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2006
Last sequence update: March 1, 2001
Last modified: November 30, 2016
This is version 121 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.