Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9EST5

- AN32B_MOUSE

UniProt

Q9EST5 - AN32B_MOUSE

Protein

Acidic leucine-rich nuclear phosphoprotein 32 family member B

Gene

Anp32b

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 104 (01 Oct 2014)
      Sequence version 1 (01 Mar 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Multifunctional protein working as a cell cycle progression factor as well as a cell survival factor. Required for the progression from the G1 to the S phase. Anti-apoptotic protein which functions as a caspase-3 inhibitor. Has no phosphatase 2A (PP2A) inhibitor activity. Exhibits histone chaperone properties, stimulating core histones to assemble into a nucleosome By similarity.By similarity

    GO - Biological processi

    1. G1/S transition of mitotic cell cycle Source: MGI
    2. inner ear development Source: MGI
    3. palate development Source: MGI
    4. vasculature development Source: MGI
    5. ventricular system development Source: MGI

    Keywords - Molecular functioni

    Chaperone

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Acidic leucine-rich nuclear phosphoprotein 32 family member B
    Alternative name(s):
    Proliferation-related acidic leucine-rich protein PAL31
    Gene namesi
    Name:Anp32b
    Synonyms:Pal31
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 4

    Organism-specific databases

    MGIiMGI:1914878. Anp32b.

    Subcellular locationi

    Nucleus
    Note: Accumulates in the nuclei at the S phase.By similarity

    GO - Cellular componenti

    1. nucleus Source: MGI

    Keywords - Cellular componenti

    Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 272272Acidic leucine-rich nuclear phosphoprotein 32 family member BPRO_0000236252Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei265 – 2651PhosphothreonineBy similarity

    Post-translational modificationi

    Some glutamate residues are glycylated by TTLL8. This modification occurs exclusively on glutamate residues and results in a glycine chain on the gamma-carboxyl group.

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9EST5.
    PaxDbiQ9EST5.
    PRIDEiQ9EST5.

    PTM databases

    PhosphoSiteiQ9EST5.

    Expressioni

    Gene expression databases

    BgeeiQ9EST5.
    CleanExiMM_ANP32B.
    GenevestigatoriQ9EST5.

    Interactioni

    Subunit structurei

    Monomer. Interacts with histones H3 and H4 By similarity.By similarity

    Protein-protein interaction databases

    BioGridi212319. 10 interactions.
    IntActiQ9EST5. 1 interaction.
    MINTiMINT-1869930.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9EST5.
    SMRiQ9EST5. Positions 1-161.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati18 – 3821LRR 1Add
    BLAST
    Repeati43 – 6422LRR 2Add
    BLAST
    Repeati65 – 8723LRR 3Add
    BLAST
    Repeati89 – 11022LRR 4Add
    BLAST
    Domaini123 – 16139LRRCTAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi146 – 272127Asp/Glu-rich (highly acidic)Add
    BLAST

    Domaini

    Histone binding is mediated by the concave surface of the LRR region.By similarity

    Sequence similaritiesi

    Belongs to the ANP32 family.Curated
    Contains 4 LRR (leucine-rich) repeats.Curated
    Contains 1 LRRCT domain.Curated

    Keywords - Domaini

    Leucine-rich repeat, Repeat

    Phylogenomic databases

    eggNOGiNOG322008.
    GeneTreeiENSGT00560000077130.
    HOGENOMiHOG000007361.
    HOVERGENiHBG053102.
    OMAiDEVSGEX.
    OrthoDBiEOG7TJ3KH.
    PhylomeDBiQ9EST5.
    TreeFamiTF317206.

    Family and domain databases

    InterProiIPR001611. Leu-rich_rpt.
    IPR003603. U2A'_phosphoprotein32A_C.
    [Graphical view]
    SMARTiSM00446. LRRcap. 1 hit.
    [Graphical view]
    PROSITEiPS51450. LRR. 3 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9EST5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDMKRRIHLE LRNRTPAAVR ELVLDNCKAM DGKIEGLTDE FVNLEFLSLI    50
    SVGLFSVSDL PKLPKLKKLE LSENRIFGGL DRLAEELPSL THLNLSGNNL 100
    KDISTLEPLK RLDCLKSLDL FGCEVTNRSD YRETVFRLLP QLSYLDGYDR 150
    EDQEAPDSDV EVDSVEEAPD SDGEVDGVDK EEEDEEGEDE EEEEDEDGEE 200
    EEDEDEEDED EDEDVEGEDD EDEVSGEEEE FGHDGEVDED EEDEDEDEDE 250
    EEEESGKGEK RKRETDDEGE DD 272
    Length:272
    Mass (Da):31,079
    Last modified:March 1, 2001 - v1
    Checksum:iBC22DC591AA6BC15
    GO
    Isoform 2 (identifier: Q9EST5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         227-227: E → EVNTTVFFPICVKTK
         269-272: GEDD → EEEPKNSSRDIPPSSVSPLVIHHQAWGLRPNKIVNVVRFSCKTLAVS

    Note: No experimental confirmation available.

    Show »
    Length:329
    Mass (Da):37,447
    Checksum:i7DDD33F69960CEE5
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei227 – 2271E → EVNTTVFFPICVKTK in isoform 2. 1 PublicationVSP_023520
    Alternative sequencei269 – 2724GEDD → EEEPKNSSRDIPPSSVSPLV IHHQAWGLRPNKIVNVVRFS CKTLAVS in isoform 2. 1 PublicationVSP_023521

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB025582 mRNA. Translation: BAB12436.1.
    AK165807 mRNA. Translation: BAE38387.1.
    AL683884 Genomic DNA. Translation: CAM13790.1.
    BC003489 mRNA. Translation: AAH03489.1.
    BC005628 mRNA. Translation: AAH05628.1.
    BC093506 mRNA. Translation: AAH93506.1.
    CCDSiCCDS18151.1. [Q9EST5-1]
    RefSeqiNP_570959.1. NM_130889.2. [Q9EST5-1]
    UniGeneiMm.263913.

    Genome annotation databases

    EnsembliENSMUST00000102926; ENSMUSP00000099990; ENSMUSG00000028333. [Q9EST5-1]
    GeneIDi67628.
    KEGGimmu:67628.
    UCSCiuc008stt.1. mouse. [Q9EST5-1]
    uc012dds.1. mouse. [Q9EST5-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB025582 mRNA. Translation: BAB12436.1 .
    AK165807 mRNA. Translation: BAE38387.1 .
    AL683884 Genomic DNA. Translation: CAM13790.1 .
    BC003489 mRNA. Translation: AAH03489.1 .
    BC005628 mRNA. Translation: AAH05628.1 .
    BC093506 mRNA. Translation: AAH93506.1 .
    CCDSi CCDS18151.1. [Q9EST5-1 ]
    RefSeqi NP_570959.1. NM_130889.2. [Q9EST5-1 ]
    UniGenei Mm.263913.

    3D structure databases

    ProteinModelPortali Q9EST5.
    SMRi Q9EST5. Positions 1-161.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 212319. 10 interactions.
    IntActi Q9EST5. 1 interaction.
    MINTi MINT-1869930.

    PTM databases

    PhosphoSitei Q9EST5.

    Proteomic databases

    MaxQBi Q9EST5.
    PaxDbi Q9EST5.
    PRIDEi Q9EST5.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000102926 ; ENSMUSP00000099990 ; ENSMUSG00000028333 . [Q9EST5-1 ]
    GeneIDi 67628.
    KEGGi mmu:67628.
    UCSCi uc008stt.1. mouse. [Q9EST5-1 ]
    uc012dds.1. mouse. [Q9EST5-2 ]

    Organism-specific databases

    CTDi 10541.
    MGIi MGI:1914878. Anp32b.

    Phylogenomic databases

    eggNOGi NOG322008.
    GeneTreei ENSGT00560000077130.
    HOGENOMi HOG000007361.
    HOVERGENi HBG053102.
    OMAi DEVSGEX.
    OrthoDBi EOG7TJ3KH.
    PhylomeDBi Q9EST5.
    TreeFami TF317206.

    Miscellaneous databases

    NextBioi 325077.
    PROi Q9EST5.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q9EST5.
    CleanExi MM_ANP32B.
    Genevestigatori Q9EST5.

    Family and domain databases

    InterProi IPR001611. Leu-rich_rpt.
    IPR003603. U2A'_phosphoprotein32A_C.
    [Graphical view ]
    SMARTi SM00446. LRRcap. 1 hit.
    [Graphical view ]
    PROSITEi PS51450. LRR. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Strain: BALB/c.
      Tissue: Brain.
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: C57BL/6J.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Strain: FVB/N and NMRI.
      Tissue: Mammary tumor.
    5. "The Anp32 family of proteins containing leucine-rich repeats."
      Matilla A., Radrizzani M.
      Cerebellum 4:7-18(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: GENE FAMILY, NOMENCLATURE.
    6. "Evolutionary divergence of enzymatic mechanisms for posttranslational polyglycylation."
      Rogowski K., Juge F., van Dijk J., Wloga D., Strub J.-M., Levilliers N., Thomas D., Bre M.-H., Van Dorsselaer A., Gaertig J., Janke C.
      Cell 137:1076-1087(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCYLATION.

    Entry informationi

    Entry nameiAN32B_MOUSE
    AccessioniPrimary (citable) accession number: Q9EST5
    Secondary accession number(s): B1AVH9, Q566J4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2006
    Last sequence update: March 1, 2001
    Last modified: October 1, 2014
    This is version 104 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3