Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9EST5 (AN32B_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 103. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Acidic leucine-rich nuclear phosphoprotein 32 family member B
Alternative name(s):
Proliferation-related acidic leucine-rich protein PAL31
Gene names
Name:Anp32b
Synonyms:Pal31
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length272 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Multifunctional protein working as a cell cycle progression factor as well as a cell survival factor. Required for the progression from the G1 to the S phase. Anti-apoptotic protein which functions as a caspase-3 inhibitor. Has no phosphatase 2A (PP2A) inhibitor activity. Exhibits histone chaperone properties, stimulating core histones to assemble into a nucleosome By similarity.

Subunit structure

Monomer. Interacts with histones H3 and H4 By similarity.

Subcellular location

Nucleus. Note: Accumulates in the nuclei at the S phase By similarity.

Domain

Histone binding is mediated by the concave surface of the LRR region By similarity.

Post-translational modification

Some glutamate residues are glycylated by TTLL8. This modification occurs exclusively on glutamate residues and results in a glycine chain on the gamma-carboxyl group.

Sequence similarities

Belongs to the ANP32 family.

Contains 4 LRR (leucine-rich) repeats.

Contains 1 LRRCT domain.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9EST5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9EST5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     227-227: E → EVNTTVFFPICVKTK
     269-272: GEDD → EEEPKNSSRDIPPSSVSPLVIHHQAWGLRPNKIVNVVRFSCKTLAVS
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 272272Acidic leucine-rich nuclear phosphoprotein 32 family member B
PRO_0000236252

Regions

Repeat18 – 3821LRR 1
Repeat43 – 6422LRR 2
Repeat65 – 8723LRR 3
Repeat89 – 11022LRR 4
Domain123 – 16139LRRCT
Compositional bias146 – 272127Asp/Glu-rich (highly acidic)

Amino acid modifications

Modified residue2651Phosphothreonine By similarity

Natural variations

Alternative sequence2271E → EVNTTVFFPICVKTK in isoform 2.
VSP_023520
Alternative sequence269 – 2724GEDD → EEEPKNSSRDIPPSSVSPLV IHHQAWGLRPNKIVNVVRFS CKTLAVS in isoform 2.
VSP_023521

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 1, 2001. Version 1.
Checksum: BC22DC591AA6BC15

FASTA27231,079
        10         20         30         40         50         60 
MDMKRRIHLE LRNRTPAAVR ELVLDNCKAM DGKIEGLTDE FVNLEFLSLI SVGLFSVSDL 

        70         80         90        100        110        120 
PKLPKLKKLE LSENRIFGGL DRLAEELPSL THLNLSGNNL KDISTLEPLK RLDCLKSLDL 

       130        140        150        160        170        180 
FGCEVTNRSD YRETVFRLLP QLSYLDGYDR EDQEAPDSDV EVDSVEEAPD SDGEVDGVDK 

       190        200        210        220        230        240 
EEEDEEGEDE EEEEDEDGEE EEDEDEEDED EDEDVEGEDD EDEVSGEEEE FGHDGEVDED 

       250        260        270 
EEDEDEDEDE EEEESGKGEK RKRETDDEGE DD 

« Hide

Isoform 2 [UniParc].

Checksum: 7DDD33F69960CEE5
Show »

FASTA32937,447

References

« Hide 'large scale' references
[1]"PAL31, a nuclear protein required for progression to the S phase."
Sun W., Hattori N., Mutai H., Toyoshima Y., Kimura H., Tanaka S., Shiota K.
Biochem. Biophys. Res. Commun. 280:1048-1054(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Strain: BALB/c.
Tissue: Brain.
[2]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: C57BL/6J.
[3]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Strain: FVB/N and NMRI.
Tissue: Mammary tumor.
[5]"The Anp32 family of proteins containing leucine-rich repeats."
Matilla A., Radrizzani M.
Cerebellum 4:7-18(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: GENE FAMILY, NOMENCLATURE.
[6]"Evolutionary divergence of enzymatic mechanisms for posttranslational polyglycylation."
Rogowski K., Juge F., van Dijk J., Wloga D., Strub J.-M., Levilliers N., Thomas D., Bre M.-H., Van Dorsselaer A., Gaertig J., Janke C.
Cell 137:1076-1087(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCYLATION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB025582 mRNA. Translation: BAB12436.1.
AK165807 mRNA. Translation: BAE38387.1.
AL683884 Genomic DNA. Translation: CAM13790.1.
BC003489 mRNA. Translation: AAH03489.1.
BC005628 mRNA. Translation: AAH05628.1.
BC093506 mRNA. Translation: AAH93506.1.
CCDSCCDS18151.1. [Q9EST5-1]
RefSeqNP_570959.1. NM_130889.2. [Q9EST5-1]
UniGeneMm.263913.

3D structure databases

ProteinModelPortalQ9EST5.
SMRQ9EST5. Positions 1-161.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid212319. 10 interactions.
IntActQ9EST5. 1 interaction.
MINTMINT-1869930.

PTM databases

PhosphoSiteQ9EST5.

Proteomic databases

MaxQBQ9EST5.
PaxDbQ9EST5.
PRIDEQ9EST5.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000102926; ENSMUSP00000099990; ENSMUSG00000028333. [Q9EST5-1]
GeneID67628.
KEGGmmu:67628.
UCSCuc008stt.1. mouse. [Q9EST5-1]
uc012dds.1. mouse. [Q9EST5-2]

Organism-specific databases

CTD10541.
MGIMGI:1914878. Anp32b.

Phylogenomic databases

eggNOGNOG322008.
GeneTreeENSGT00560000077130.
HOGENOMHOG000007361.
HOVERGENHBG053102.
OMADEVSGEX.
OrthoDBEOG7TJ3KH.
PhylomeDBQ9EST5.
TreeFamTF317206.

Gene expression databases

BgeeQ9EST5.
CleanExMM_ANP32B.
GenevestigatorQ9EST5.

Family and domain databases

InterProIPR001611. Leu-rich_rpt.
IPR003603. U2A'_phosphoprotein32A_C.
[Graphical view]
SMARTSM00446. LRRcap. 1 hit.
[Graphical view]
PROSITEPS51450. LRR. 3 hits.
[Graphical view]
ProtoNetSearch...

Other

NextBio325077.
PROQ9EST5.
SOURCESearch...

Entry information

Entry nameAN32B_MOUSE
AccessionPrimary (citable) accession number: Q9EST5
Secondary accession number(s): B1AVH9, Q566J4
Entry history
Integrated into UniProtKB/Swiss-Prot: May 30, 2006
Last sequence update: March 1, 2001
Last modified: July 9, 2014
This is version 103 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot