Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centromere protein K

Gene

Cenpk

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex. Acts in coordination with CASC5/KNL1 to recruit the NDC80 complex to the outer kinetochore (By similarity).By similarity

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

ReactomeiREACT_286371. Deposition of new CENPA-containing nucleosomes at the centromere.
REACT_306375. Mitotic Prometaphase.
REACT_321346. Separation of Sister Chromatids.
REACT_329805. Resolution of Sister Chromatid Cohesion.
REACT_358264. RHO GTPases Activate Formins.

Names & Taxonomyi

Protein namesi
Recommended name:
Centromere protein K
Short name:
CENP-K
Alternative name(s):
SoxLZ/Sox6 leucine zipper-binding protein in testis
Gene namesi
Name:Cenpk
Synonyms:Solt
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589 Componenti: Chromosome 13

Organism-specific databases

MGIiMGI:1926210. Cenpk.

Subcellular locationi

GO - Cellular componenti

  • condensed chromosome kinetochore Source: UniProtKB-SubCell
  • nucleus Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Centromere, Chromosome, Kinetochore, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 271271Centromere protein KPRO_0000249483Add
BLAST

Proteomic databases

PRIDEiQ9ESN5.

PTM databases

PhosphoSiteiQ9ESN5.

Expressioni

Tissue specificityi

Highly expressed in testis.1 Publication

Gene expression databases

BgeeiQ9ESN5.
CleanExiMM_CENPK.
GenevisibleiQ9ESN5. MM.

Interactioni

Subunit structurei

Component of the CENPA-CAD complex, composed of CENPI, CENPK, CENPL, CENPO, CENPP, CENPQ, CENPR and CENPS. The CENPA-CAD complex interacts with the CENPA-NAC complex, at least composed of CENPA, CENPC, CENPH, CENPM, CENPN, CENPT and CENPU. May interact with Sox6.

Protein-protein interaction databases

IntActiQ9ESN5. 1 interaction.
MINTiMINT-8174098.
STRINGi10090.ENSMUSP00000022227.

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili11 – 4434Sequence AnalysisAdd
BLAST
Coiled coili102 – 15150Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Belongs to the CENPK family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG46525.
GeneTreeiENSGT00390000006243.
HOGENOMiHOG000111542.
HOVERGENiHBG081084.
InParanoidiQ9ESN5.
KOiK11503.
OrthoDBiEOG780RN0.
PhylomeDBiQ9ESN5.
TreeFamiTF333264.

Family and domain databases

InterProiIPR020993. Centromere_CenpK.
[Graphical view]
PfamiPF11802. CENP-K. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ESN5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSENKQEVHP DTITDVEAVI DTEEELIKEC EEMWKDMEDC QNKLSLIGTE
60 70 80 90 100
TLTNADAQLS LLIMQMKCLT AELGQWKKRK PEIIPLNEDV LLTLGKEEFQ
110 120 130 140 150
KLRCDLEMVL STIQSKNEKL KEDLEREQQW LDEQQQILDT LNVLNSDVEN
160 170 180 190 200
QVVTLTESRI FNELTTKIRG IKEFKEKLLL TLGAFLDNHF PLPEASTPKK
210 220 230 240 250
RKNIQDSNAQ LITLNEILEM LINRMFDVPH DPYVKIRDSF WPPYIELLLR
260 270
YGIALRHPED PSQIRLEAFH Q
Length:271
Mass (Da):31,686
Last modified:September 19, 2006 - v2
Checksum:i0805A7930078B014
GO
Isoform 2 (identifier: Q9ESN5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     220-271: MLINRMFDVP...SQIRLEAFHQ → VPLRAMGSTLESCWFPRETLLEEAAFSLASASVG

Note: No experimental confirmation available.
Show »
Length:253
Mass (Da):28,978
Checksum:i066A7EF2AB4DD2DD
GO
Isoform 3 (identifier: Q9ESN5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-107: Missing.
     266-271: LEAFHQ → TSCMVGACGDQKSHH

Note: No experimental confirmation available.
Show »
Length:173
Mass (Da):20,140
Checksum:iEA4651E29E5F58A7
GO

Sequence cautioni

The sequence AAH92351.1 differs from that shown.Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAB16367.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti115 – 1151S → T in AAH92351 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 107107Missing in isoform 3. 1 PublicationVSP_020437Add
BLAST
Alternative sequencei220 – 27152MLINR…EAFHQ → VPLRAMGSTLESCWFPRETL LEEAAFSLASASVG in isoform 2. 1 PublicationVSP_020438Add
BLAST
Alternative sequencei266 – 2716LEAFHQ → TSCMVGACGDQKSHH in isoform 3. 1 PublicationVSP_020439

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB043687 mRNA. Translation: BAB16367.1. Different initiation.
AK082939 mRNA. Translation: BAC38702.1.
AK135773 mRNA. Translation: BAE22654.1.
BC092351 mRNA. Translation: AAH92351.1. Sequence problems.
CCDSiCCDS26750.1. [Q9ESN5-2]
RefSeqiNP_068562.1. NM_021790.2.
NP_851406.1. NM_181061.5. [Q9ESN5-2]
UniGeneiMm.281498.

Genome annotation databases

EnsembliENSMUST00000070761; ENSMUSP00000070910; ENSMUSG00000021714. [Q9ESN5-2]
GeneIDi60411.
KEGGimmu:60411.
UCSCiuc007rtc.2. mouse. [Q9ESN5-2]
uc007rtd.2. mouse. [Q9ESN5-1]
uc007rtf.1. mouse. [Q9ESN5-3]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB043687 mRNA. Translation: BAB16367.1. Different initiation.
AK082939 mRNA. Translation: BAC38702.1.
AK135773 mRNA. Translation: BAE22654.1.
BC092351 mRNA. Translation: AAH92351.1. Sequence problems.
CCDSiCCDS26750.1. [Q9ESN5-2]
RefSeqiNP_068562.1. NM_021790.2.
NP_851406.1. NM_181061.5. [Q9ESN5-2]
UniGeneiMm.281498.

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ9ESN5. 1 interaction.
MINTiMINT-8174098.
STRINGi10090.ENSMUSP00000022227.

PTM databases

PhosphoSiteiQ9ESN5.

Proteomic databases

PRIDEiQ9ESN5.

Protocols and materials databases

DNASUi60411.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000070761; ENSMUSP00000070910; ENSMUSG00000021714. [Q9ESN5-2]
GeneIDi60411.
KEGGimmu:60411.
UCSCiuc007rtc.2. mouse. [Q9ESN5-2]
uc007rtd.2. mouse. [Q9ESN5-1]
uc007rtf.1. mouse. [Q9ESN5-3]

Organism-specific databases

CTDi64105.
MGIiMGI:1926210. Cenpk.

Phylogenomic databases

eggNOGiNOG46525.
GeneTreeiENSGT00390000006243.
HOGENOMiHOG000111542.
HOVERGENiHBG081084.
InParanoidiQ9ESN5.
KOiK11503.
OrthoDBiEOG780RN0.
PhylomeDBiQ9ESN5.
TreeFamiTF333264.

Enzyme and pathway databases

ReactomeiREACT_286371. Deposition of new CENPA-containing nucleosomes at the centromere.
REACT_306375. Mitotic Prometaphase.
REACT_321346. Separation of Sister Chromatids.
REACT_329805. Resolution of Sister Chromatid Cohesion.
REACT_358264. RHO GTPases Activate Formins.

Miscellaneous databases

NextBioi314857.
PROiQ9ESN5.
SOURCEiSearch...

Gene expression databases

BgeeiQ9ESN5.
CleanExiMM_CENPK.
GenevisibleiQ9ESN5. MM.

Family and domain databases

InterProiIPR020993. Centromere_CenpK.
[Graphical view]
PfamiPF11802. CENP-K. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of Solt, a novel SoxLZ/Sox6 binding protein expressed in adult mouse testis."
    Yamashita A., Ito M., Takamatsu N., Shiba T.
    FEBS Lett. 481:147-151(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, POSSIBLE INTERACTION WITH SOX6.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Strain: C57BL/6J.
    Tissue: Egg and Spinal cord.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-120.
    Strain: NMRI.
    Tissue: Mammary tumor.

Entry informationi

Entry nameiCENPK_MOUSE
AccessioniPrimary (citable) accession number: Q9ESN5
Secondary accession number(s): Q3UXA9, Q569Q3, Q8C469
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 19, 2006
Last sequence update: September 19, 2006
Last modified: July 22, 2015
This is version 86 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.