Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9ESN5 (CENPK_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 76. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Centromere protein K

Short name=CENP-K
Alternative name(s):
SoxLZ/Sox6 leucine zipper-binding protein in testis
Gene names
Name:Cenpk
Synonyms:Solt
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length271 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex. Acts in coordination with CASC5/KNL1 to recruit the NDC80 complex to the outer kinetochore By similarity.

Subunit structure

Component of the CENPA-CAD complex, composed of CENPI, CENPK, CENPL, CENPO, CENPP, CENPQ, CENPR and CENPS. The CENPA-CAD complex interacts with the CENPA-NAC complex, at least composed of CENPA, CENPC, CENPH, CENPM, CENPN, CENPT and CENPU. May interact with Sox6. Ref.1

Subcellular location

Nucleus By similarity. Chromosomecentromere By similarity. Chromosomecentromerekinetochore By similarity. Note: Localizes exclusively in the centromeres. The CENPA-CAD complex is probably recruited on centromeres by the CENPA-NAC complex By similarity. Ref.1

Tissue specificity

Highly expressed in testis. Ref.1

Sequence similarities

Belongs to the CENPK family.

Sequence caution

The sequence AAH92351.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.

The sequence BAB16367.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9ESN5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9ESN5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     220-271: MLINRMFDVP...SQIRLEAFHQ → VPLRAMGSTLESCWFPRETLLEEAAFSLASASVG
Note: No experimental confirmation available.
Isoform 3 (identifier: Q9ESN5-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-107: Missing.
     266-271: LEAFHQ → TSCMVGACGDQKSHH
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 271271Centromere protein K
PRO_0000249483

Regions

Coiled coil11 – 4434 Potential
Coiled coil102 – 15150 Potential

Natural variations

Alternative sequence1 – 107107Missing in isoform 3.
VSP_020437
Alternative sequence220 – 27152MLINR…EAFHQ → VPLRAMGSTLESCWFPRETL LEEAAFSLASASVG in isoform 2.
VSP_020438
Alternative sequence266 – 2716LEAFHQ → TSCMVGACGDQKSHH in isoform 3.
VSP_020439

Experimental info

Sequence conflict1151S → T in AAH92351. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified September 19, 2006. Version 2.
Checksum: 0805A7930078B014

FASTA27131,686
        10         20         30         40         50         60 
MSENKQEVHP DTITDVEAVI DTEEELIKEC EEMWKDMEDC QNKLSLIGTE TLTNADAQLS 

        70         80         90        100        110        120 
LLIMQMKCLT AELGQWKKRK PEIIPLNEDV LLTLGKEEFQ KLRCDLEMVL STIQSKNEKL 

       130        140        150        160        170        180 
KEDLEREQQW LDEQQQILDT LNVLNSDVEN QVVTLTESRI FNELTTKIRG IKEFKEKLLL 

       190        200        210        220        230        240 
TLGAFLDNHF PLPEASTPKK RKNIQDSNAQ LITLNEILEM LINRMFDVPH DPYVKIRDSF 

       250        260        270 
WPPYIELLLR YGIALRHPED PSQIRLEAFH Q 

« Hide

Isoform 2 [UniParc].

Checksum: 066A7EF2AB4DD2DD
Show »

FASTA25328,978
Isoform 3 [UniParc].

Checksum: EA4651E29E5F58A7
Show »

FASTA17320,140

References

« Hide 'large scale' references
[1]"Characterization of Solt, a novel SoxLZ/Sox6 binding protein expressed in adult mouse testis."
Yamashita A., Ito M., Takamatsu N., Shiba T.
FEBS Lett. 481:147-151(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, POSSIBLE INTERACTION WITH SOX6.
[2]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
Strain: C57BL/6J.
Tissue: Egg and Spinal cord.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-120.
Strain: NMRI.
Tissue: Mammary tumor.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB043687 mRNA. Translation: BAB16367.1. Different initiation.
AK082939 mRNA. Translation: BAC38702.1.
AK135773 mRNA. Translation: BAE22654.1.
BC092351 mRNA. Translation: AAH92351.1. Sequence problems.
CCDSCCDS26750.1. [Q9ESN5-2]
RefSeqNP_068562.1. NM_021790.2.
NP_851406.1. NM_181061.5. [Q9ESN5-2]
XP_006517792.1. XM_006517729.1. [Q9ESN5-1]
XP_006517793.1. XM_006517730.1. [Q9ESN5-1]
UniGeneMm.281498.

3D structure databases

ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActQ9ESN5. 1 interaction.
MINTMINT-8174098.

PTM databases

PhosphoSiteQ9ESN5.

Proteomic databases

PRIDEQ9ESN5.

Protocols and materials databases

DNASU60411.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000022227; ENSMUSP00000022227; ENSMUSG00000021714.
ENSMUST00000070761; ENSMUSP00000070910; ENSMUSG00000021714. [Q9ESN5-2]
GeneID60411.
KEGGmmu:60411.
UCSCuc007rtc.1. mouse. [Q9ESN5-2]
uc007rtd.1. mouse. [Q9ESN5-1]
uc007rtf.1. mouse. [Q9ESN5-3]

Organism-specific databases

CTD64105.
MGIMGI:1926210. Cenpk.

Phylogenomic databases

eggNOGNOG46525.
GeneTreeENSGT00390000006243.
HOGENOMHOG000111542.
HOVERGENHBG081084.
InParanoidQ9ESN5.
KOK11503.
OMACESKNET.
OrthoDBEOG780RN0.
PhylomeDBQ9ESN5.
TreeFamTF333264.

Gene expression databases

BgeeQ9ESN5.
CleanExMM_CENPK.
GenevestigatorQ9ESN5.

Family and domain databases

InterProIPR020993. Centromere_CenpK.
[Graphical view]
PfamPF11802. CENP-K. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio314857.
PROQ9ESN5.
SOURCESearch...

Entry information

Entry nameCENPK_MOUSE
AccessionPrimary (citable) accession number: Q9ESN5
Secondary accession number(s): Q3UXA9, Q569Q3, Q8C469
Entry history
Integrated into UniProtKB/Swiss-Prot: September 19, 2006
Last sequence update: September 19, 2006
Last modified: July 9, 2014
This is version 76 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot