Q9ESD7 (DYSF_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 107.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Dysferlin Alternative name(s): Dystrophy-associated fer-1-like protein Fer-1-like protein 1 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 2090 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Key calcium ion sensor involved in the Ca2+-triggered synaptic vesicle-plasma membrane fusion. Plays a role in the sarcolemma repair mechanism of both skeletal muscle and cardiomyocytes that permits rapid resealing of membranes disrupted by mechanical stress. Ref.6 Ref.7 Ref.10 |
| Subunit structure | Interacts with CAV3. Interacts with AHNAK; the interaction is direct and Ca2+-independent. Interacts with AHNAK2; the interaction is direct and Ca2+-independent By similarity. Interacts with ANXA1; the interaction is Ca2+- and injury state-dependent. Interacts with ANXA2; the interaction is Ca2+- and injury state-dependent. Interacts with CACNA1S and PARVB. Interacts with TRIM72/MG53; interaction is required for transport to sites of cell injury during repair patch formation. Ref.6 Ref.8 Ref.9 Ref.12 |
| Subcellular location | Cell membrane › sarcolemma; Single-pass type II membrane protein. Cytoplasmic vesicle membrane; Single-pass type II membrane protein. Note: Colocalizes, during muscle differentiation, with BIN1 in the T-tubule system of myotubules and at the site of contact between two myotubes or a myoblast and a myotube By similarity. Accumulates and colocalizes with fusion vesicles at the sarcolemma disruption sites. Wounding of myotubes led to its focal enrichment to the site of injury and to its relocalization in a Ca2+-dependent manner toward the plasma membrane By similarity. Colocalizes with ANXA1 and ANXA2 at the sarcolemma in skeletal muscle. Colocalizes with PARVB at the sarcolemma of skeletal muscle By similarity. Retained by caveolin at the plasmma membrane. Reaches the plasmma membrane through a caveolin-independent mechanism. Colocalizes, during muscle differentiation, with CACNA1S in the T-tubule system of myotubules. Detected on the apical plasma membrane of the syncytiotrophoblast By similarity. Ref.6 Ref.7 Ref.8 Ref.10 Ref.11 |
| Tissue specificity | Expressed in skeletal and cardiac muscles (at protein level). Expressed in skeletal muscle and heart. Also found in brain, liver and kidney. Ref.1 Ref.7 |
| Domain | The C2 domain 1 associates with lipid membranes in a calcium-dependent manner By similarity. |
| Involvement in disease | Defects in Dysf are the cause of a slowly progressive muscular dystrophy observed in SJL mice. It affects primarily the proximal muscles and it is inherited as autosomal recessive trait. |
| Miscellaneous | Mice lacking Dysf maintain a functional dystrophin glycoprotein complex (DGC) but their muscle cells are defective in repairing the plasma membrane disruptions and accumulates vesicles at the sarcolemma. They develop a progressive muscular dystrophy and cardiomyopathy. |
| Sequence similarities | Belongs to the ferlin family. Contains 5 C2 domains. |
| Sequence caution | The sequence BAD21394.1 differs from that shown. Reason: Erroneous initiation. The sequence CAB63111.1 differs from that shown. Reason: The sequence differs significantly from amino acid position 1855. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Cytoplasmic vesicle Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat Signal-anchor Transmembrane Transmembrane helix |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | plasma membrane repair Inferred from mutant phenotype Ref.7. Source: UniProtKB vesicle fusionInferred from mutant phenotype Ref.7. Source: UniProtKB |
| Cellular_component | T-tubule Inferred from direct assay PubMed 16319126. Source: MGI cytoplasmic vesicleInferred from direct assay Ref.7. Source: UniProtKB cytoplasmic vesicle membraneInferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW lamellipodiumInferred from direct assay PubMed 18325335. Source: UniProtKB |
| Molecular_function | calcium-dependent phospholipid binding Inferred from electronic annotation. Source: Compara |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9ESD7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9ESD7-2) The sequence of this isoform differs from the canonical sequence as follows: 1-29: MLRVFILFAENVHTPDSDISDAYCSAVFA → MLCCLLARASNLPNVKKDRRSDPVASLIFR 152-152: P → PGGGQSRAETWSLLSDSTMDTRYSGKKWPVPT 496-510: EEPAGVLKSPQATDL → V 647-654: Missing. | ||||||
| Isoform 3 (identifier: Q9ESD7-3) The sequence of this isoform differs from the canonical sequence as follows: 1-29: MLRVFILFAENVHTPDSDISDAYCSAVFA → MLCCLLARASNLPNVKKDRRSDPVASLIFR 496-510: EEPAGVLKSPQATDL → V 647-654: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 2090 | 2090 | Dysferlin | PRO_0000057880 | |||||
Regions | |||||||||
| Topological domain | 1 – 2056 | 2056 | Cytoplasmic Potential | ||||||
| Transmembrane | 2057 – 2077 | 21 | Helical; Potential | ||||||
| Topological domain | 2078 – 2090 | 13 | Extracellular Potential | ||||||
| Domain | 1 – 85 | 85 | C2 1 | ||||||
| Domain | 209 – 304 | 96 | C2 2 | ||||||
| Domain | 368 – 486 | 119 | C2 3 | ||||||
| Domain | 1149 – 1254 | 106 | C2 4 | ||||||
| Domain | 1575 – 1673 | 99 | C2 5 | ||||||
| Compositional bias | 1048 – 1107 | 60 | Arg-rich | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 29 | 29 | MLRVF…SAVFA → MLCCLLARASNLPNVKKDRR SDPVASLIFR in isoform 2 and isoform 3. | VSP_035930 | |||||
| Alternative sequence | 152 | 1 | P → PGGGQSRAETWSLLSDSTMD TRYSGKKWPVPT in isoform 2. | VSP_035931 | |||||
| Alternative sequence | 496 – 510 | 15 | EEPAG…QATDL → V in isoform 2 and isoform 3. | VSP_035932 | |||||
| Alternative sequence | 647 – 654 | 8 | Missing in isoform 2 and isoform 3. | VSP_035933 | |||||
Experimental info | |||||||||
| Sequence conflict | 467 | 1 | D → G in CAB63111. Ref.4 | ||||||
| Sequence conflict | 476 | 1 | T → I in AAG17046. Ref.1 | ||||||
| Sequence conflict | 510 | 1 | L → V in CAB63111. Ref.4 | ||||||
| Sequence conflict | 684 | 1 | I → T in AAG17046. Ref.1 | ||||||
| Sequence conflict | 690 – 691 | 2 | RV → GI in AAG17046. Ref.1 | ||||||
| Sequence conflict | 698 | 1 | N → G in AAG17046. Ref.1 | ||||||
| Sequence conflict | 712 | 1 | S → T in AAG17046. Ref.1 | ||||||
| Sequence conflict | 717 | 1 | A → S in AAG17046. Ref.1 | ||||||
| Sequence conflict | 727 | 1 | L → I in AAG17046. Ref.1 | ||||||
| Sequence conflict | 885 | 1 | L → F in AAG17046. Ref.1 | ||||||
| Sequence conflict | 909 – 910 | 2 | LT → FS in AAG17046. Ref.1 | ||||||
| Sequence conflict | 931 | 1 | S → T in AAG17046. Ref.1 | ||||||
| Sequence conflict | 953 | 1 | D → A in AAG17046. Ref.1 | ||||||
| Sequence conflict | 1175 | 1 | P → A in AAG17046. Ref.1 | ||||||
| Sequence conflict | 1187 | 1 | A → S in CAB63111. Ref.4 | ||||||
| Sequence conflict | 1694 | 1 | Y → C in AAG17046. Ref.1 | ||||||
| Sequence conflict | 1701 | 1 | Q → K in AAG17046. Ref.1 | ||||||
| Sequence conflict | 1705 | 1 | Q → K in AAG17046. Ref.1 | ||||||
| Sequence conflict | 1806 | 1 | R → Q in AAG17046. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of the mouse dysferlin gene and genomic characterization of the SJL-Dysf mutation." Vafiadaki E., Reis A., Keers S., Harrison R., Anderson L.V.B., Raffelsberger T., Ivanova S., Hoeger H., Bittner R.E., Bushby K.M.D., Bashir R. NeuroReport 12:625-629(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY. Strain: BALB/c, C57BL/10 and SJL/J. Tissue: Skeletal muscle. |
| [2] | "Prediction of the coding sequences of mouse homologues of FLJ genes: the complete nucleotide sequences of 110 mouse FLJ-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Kitamura H., Nakagawa T., Nagase T., Ohara O., Koga H. DNA Res. 11:127-135(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Thymus. |
| [3] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [4] | "Dysferlin deletion in SJL mice (SJL-Dysf) defines a natural model for limb girdle muscular dystrophy 2B." Bittner R.E., Anderson L.V.B., Burkhardt E., Bashir R., Vafiadaki E., Ivanova S., Raffelsberger T., Maerk I., Hoeger H., Jung M., Karbasiyan M., Storch M., Lassmann H., Moss J.A., Davison K., Harrison R., Bushby K.M.D., Reis A. Nat. Genet. 23:141-142(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 467-1854 (ISOFORMS 1/2). Strain: B6C3FE, BALB/c, C3H, C57BL/10 and C57BL/6. Tissue: Muscle. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1490-2090 (ISOFORMS 1/2/3). Tissue: Mammary tumor. |
| [6] | "Dysferlin interacts with annexins A1 and A2 and mediates sarcolemmal wound-healing." Lennon N.J., Kho A., Bacskai B.J., Perlmutter S.L., Hyman B.T., Brown R.H. Jr. J. Biol. Chem. 278:50466-50473(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH ANXA1 AND ANXA2, SUBCELLULAR LOCATION. |
| [7] | "Defective membrane repair in dysferlin-deficient muscular dystrophy." Bansal D., Miyake K., Vogel S.S., Groh S., Chen C.C., Williamson R., McNeil P.L., Campbell K.P. Nature 423:168-172(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [8] | "Intracellular localization of dysferlin and its association with the dihydropyridine receptor." Ampong B.N., Imamura M., Matsumiya T., Yoshida M., Takeda S. Acta Myol. 24:134-144(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CACNA1S, SUBCELLULAR LOCATION. |
| [9] | "Dysferlin interacts with affixin (beta-parvin) at the sarcolemma." Matsuda C., Kameyama K., Tagawa K., Ogawa M., Suzuki A., Yamaji S., Okamoto H., Nishino I., Hayashi Y.K. J. Neuropathol. Exp. Neurol. 64:334-340(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PARVB. |
| [10] | "Dysferlin-mediated membrane repair protects the heart from stress-induced left ventricular injury." Han R., Bansal D., Miyake K., Muniz V.P., Weiss R.M., McNeil P.L., Campbell K.P. J. Clin. Invest. 117:1805-1813(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [11] | "Caveolin regulates endocytosis of the muscle repair protein, dysferlin." Hernandez-Deviez D.J., Howes M.T., Laval S.H., Bushby K., Hancock J.F., Parton R.G. J. Biol. Chem. 283:6476-6488(2008) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [12] | "Membrane repair defects in muscular dystrophy are linked to altered interaction between MG53, caveolin-3, and dysferlin." Cai C., Weisleder N., Ko J.-K., Komazaki S., Sunada Y., Nishi M., Takeshima H., Ma J. J. Biol. Chem. 284:15894-15902(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TRIM72. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF188290 mRNA. Translation: AAG17046.2. AK131144 mRNA. Translation: BAD21394.1. Different initiation. AC153607 Genomic DNA. No translation available. AC153608 Genomic DNA. No translation available. AJ242954 mRNA. Translation: CAB63111.1. Sequence problems. BC043692 mRNA. Translation: AAH43692.1. |
| IPI | IPI00113271. IPI00831354. IPI00915517. |
| RefSeq | NP_067444.2. NM_021469.2. |
| UniGene | Mm.220982. |
3D structure databases | |
| ProteinModelPortal | Q9ESD7. |
| SMR | Q9ESD7. Positions 1-128, 952-1062, 1156-1275, 1584-1675. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-274938. |
PTM databases | |
| PhosphoSite | Q9ESD7. |
Proteomic databases | |
| PaxDb | Q9ESD7. |
| PRIDE | Q9ESD7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000081904; ENSMUSP00000080579; ENSMUSG00000033788. ENSMUST00000113818; ENSMUSP00000109449; ENSMUSG00000033788. ENSMUST00000168387; ENSMUSP00000132297; ENSMUSG00000033788. |
| GeneID | 26903. |
| KEGG | mmu:26903. |
| UCSC | uc009cor.1. mouse. uc009cou.1. mouse. |
Organism-specific databases | |
| CTD | 8291. |
| MGI | MGI:1349385. Dysf. |
Phylogenomic databases | |
| eggNOG | NOG330124. |
| GeneTree | ENSGT00550000074414. |
| HOGENOM | HOG000006771. |
| HOVERGEN | HBG018972. |
| InParanoid | Q6KAR3. |
| OMA | KRHRQAE. |
Gene expression databases | |
| ArrayExpress | Q9ESD7. |
| Bgee | Q9ESD7. |
| CleanEx | MM_DYSF. |
| Genevestigator | Q9ESD7. |
| GermOnline | ENSMUSG00000033788. Mus musculus. |
Family and domain databases | |
| InterPro | IPR000008. C2_Ca-dep. IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR018029. C2_membr_targeting. IPR012968. FerIin-domain. IPR012560. Ferlin_A-domain. IPR012561. Ferlin_B-domain. IPR010482. Peroxin/Dysferlin. IPR006614. Peroxin/Ferlin. [Graphical view] |
| Pfam | PF00168. C2. 8 hits. PF08165. FerA. 1 hit. PF08150. FerB. 1 hit. PF08151. FerI. 1 hit. PF06398. Pex24p. 1 hit. [Graphical view] |
| SMART | SM00239. C2. 7 hits. SM00694. DysFC. 2 hits. SM00693. DysFN. 2 hits. [Graphical view] |
| SUPFAM | SSF49562. C2_CaLB. 7 hits. |
| PROSITE | PS50004. C2. 5 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 304757. |
| SOURCE | Search... |
Entry information
| Entry name | DYSF_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9ESD7 Secondary accession number(s): Q6KAR3, Q80VT0, Q9QXC0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
