Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Adhesion G protein-coupled receptor L4

Gene

Adgrl4

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Endothelial orphan receptor that acts as a key regulator of angiogenesis.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer
LigandCalcium

Protein family/group databases

MEROPSiP02.013

Names & Taxonomyi

Protein namesi
Recommended name:
Adhesion G protein-coupled receptor L4
Alternative name(s):
EGF,latrophilin and seven transmembrane domain-containing protein 1
EGF-TM7-latrophilin-related protein
Short name:
ETL protein
Gene namesi
Name:Adgrl4
Synonyms:Eltd1, Etl
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 2

Organism-specific databases

RGDi621136 Adgrl4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini20 – 480ExtracellularCuratedAdd BLAST461
Transmembranei481 – 501Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini502 – 522CytoplasmicCuratedAdd BLAST21
Transmembranei523 – 543Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini544 – 547ExtracellularCurated4
Transmembranei548 – 568Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini569 – 580CytoplasmicCuratedAdd BLAST12
Transmembranei581 – 601Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini602 – 621ExtracellularCuratedAdd BLAST20
Transmembranei622 – 642Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini643 – 666CytoplasmicCuratedAdd BLAST24
Transmembranei667 – 687Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini688 – 694ExtracellularCurated7
Transmembranei695 – 715Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini716 – 738CytoplasmicCuratedAdd BLAST23

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi455T → A: Abolishes cleavage. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 19Sequence analysisAdd BLAST19
ChainiPRO_000001287220 – 738Adhesion G protein-coupled receptor L4Add BLAST719

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi22 ↔ 32PROSITE-ProRule annotation
Disulfide bondi26 ↔ 41PROSITE-ProRule annotation
Disulfide bondi43 ↔ 55PROSITE-ProRule annotation
Disulfide bondi61 ↔ 73PROSITE-ProRule annotation
Glycosylationi62N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi67 ↔ 82PROSITE-ProRule annotation
Disulfide bondi84 ↔ 105PROSITE-ProRule annotation
Disulfide bondi111 ↔ 123PROSITE-ProRule annotation
Glycosylationi112N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi117 ↔ 132PROSITE-ProRule annotation
Disulfide bondi134 ↔ 155PROSITE-ProRule annotation
Glycosylationi175N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi226N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi297N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi421N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi429N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi443N-linked (GlcNAc...) asparagineSequence analysis1

Post-translational modificationi

Proteolytically cleaved into 2 subunits, an extracellular alpha subunit and a seven-transmembrane subunit.1 Publication
Glycosylated.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei454 – 455Cleavage1 Publication2

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9ESC1
PRIDEiQ9ESC1

PTM databases

PhosphoSitePlusiQ9ESC1

Expressioni

Tissue specificityi

Abundantly expressed in heart, lung, and kidney. Less evident expression is observed in brain, skeletal muscle, liver and spleen. No expression is detected in testis.1 Publication

Developmental stagei

Up-regulated in the adult heart.1 Publication

Gene expression databases

BgeeiENSRNOG00000033940
GenevisibleiQ9ESC1 RN

Interactioni

Subunit structurei

Heterodimer of 2 chains generated by proteolytic processing; the large extracellular N-terminal fragment and the membrane-bound C-terminal fragment predominantly remain associated and non-covalently linked.1 Publication

GO - Molecular functioni

  • protein dimerization activity Source: RGD

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000045890

Structurei

3D structure databases

ProteinModelPortaliQ9ESC1
SMRiQ9ESC1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini20 – 56EGF-like 1PROSITE-ProRule annotationAdd BLAST37
Domaini57 – 106EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd BLAST50
Domaini107 – 156EGF-like 3; calcium-bindingPROSITE-ProRule annotationAdd BLAST50
Domaini414 – 466GPSPROSITE-ProRule annotationAdd BLAST53

Domaini

The transmembrane domain is not required for cleavage, but it is required for dimer formation.1 Publication

Sequence similaritiesi

Keywords - Domaini

EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4193 Eukaryota
ENOG410XSD2 LUCA
GeneTreeiENSGT00900000140800
HOGENOMiHOG000112361
HOVERGENiHBG101117
InParanoidiQ9ESC1
KOiK04595
OMAiYKVFRHT
PhylomeDBiQ9ESC1
TreeFamiTF316380

Family and domain databases

InterProiView protein in InterPro
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR032471 GAIN_dom_N
IPR017981 GPCR_2-like
IPR000832 GPCR_2_secretin-like
IPR017983 GPCR_2_secretin-like_CS
IPR000203 GPS
PfamiView protein in Pfam
PF00002 7tm_2, 1 hit
PF07645 EGF_CA, 2 hits
PF16489 GAIN, 1 hit
PF01825 GPS, 1 hit
PRINTSiPR00249 GPCRSECRETIN
SMARTiView protein in SMART
SM00181 EGF, 3 hits
SM00179 EGF_CA, 2 hits
SM00303 GPS, 1 hit
PROSITEiView protein in PROSITE
PS00010 ASX_HYDROXYL, 2 hits
PS01186 EGF_2, 1 hit
PS50026 EGF_3, 3 hits
PS01187 EGF_CA, 2 hits
PS00650 G_PROTEIN_RECEP_F2_2, 1 hit
PS50261 G_PROTEIN_RECEP_F2_4, 1 hit
PS50221 GPS, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ESC1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRLLLLLVGL STLLNHSYTQ NCKTPCLPNA KCEVLDEVAA CFCSTGYTGN
60 70 80 90 100
GITICEDVDE CNETSVCGDH AVCENTNGGF SCFCVEGYQT STGKTQFTPN
110 120 130 140 150
DGSYCQDVDE CNETSVCGDH AVCENTNGGF SCFCVEGYQT STGKTQFTPN
160 170 180 190 200
DGSYCQEIVN SNCHLEHDCI AANINKTLKR IGPITEQLTL LHEIYKNSEA
210 220 230 240 250
ELSLVDIVTY IEILTESSSL QGYIKNTTSP KDAYFGSALT EFGKTVNNFV
260 270 280 290 300
EKNTHEMWDQ LPTNRRRLHL TKLMHAAEHV TLQISQNIQK NTQFDMNSTD
310 320 330 340 350
LALKVFVFDS VHMKHTHPHM NVDGGYVKIS PRRKSAYDPN GNVIVAFLCY
360 370 380 390 400
RSIGPLLSSS DDFLLGAQSD NSKGKEKVIS SVISASISSN PPTLYELEKI
410 420 430 440 450
TFTLSHVKLS DKHQTQCAFW NYSVDDMNNG SWSSEGCELT YSNDTHTSCR
460 470 480 490 500
CSHLTHFAIL MSPSTSIEVK DYNILTRITQ LGIIISLICL AICIFTFWFF
510 520 530 540 550
SEIQSTRTTI HKNLCCSLFL AQLVFLVGIN INTNKLVCSI IAGLLHYFFL
560 570 580 590 600
AAFAWMCIEG IYLYLIVVGL IYNKGFLHKN FYIFGYLSPA VVVGFSASLG
610 620 630 640 650
YRYYGTTKVC WLSTENNFIW SFIGPACLII LVNLLAFGVI IYKVFRHTAG
660 670 680 690 700
LKPEVSCYEN IRSCARGALA LLFLLGTTWT FGVLHVVHAS VVTAYLFTVS
710 720 730
NAFQGMFIFL FLCVLSRKIQ EEYYRLFKNV PCCFECLR
Length:738
Mass (Da):82,451
Last modified:March 1, 2001 - v1
Checksum:i680D3731FE60EF95
GO
Isoform 2 (identifier: Q9ESC1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     632-662: VNLLAFGVIIYKVFRHTAGLKPEVSCYENIR → IYILVSFTSHIPLNMCAECRRMVSASLHVRL
     663-738: Missing.

Show »
Length:662
Mass (Da):73,803
Checksum:i0FED646DD20F6F30
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_009415632 – 662VNLLA…YENIR → IYILVSFTSHIPLNMCAECR RMVSASLHVRL in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_009416663 – 738Missing in isoform 2. 1 PublicationAdd BLAST76

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF192401 mRNA Translation: AAG33019.1
AF192402 mRNA Translation: AAG33020.1
RefSeqiNP_071630.1, NM_022294.1 [Q9ESC1-1]
UniGeneiRn.8731

Genome annotation databases

EnsembliENSRNOT00000047564; ENSRNOP00000045890; ENSRNOG00000033940 [Q9ESC1-2]
ENSRNOT00000088437; ENSRNOP00000071560; ENSRNOG00000033940 [Q9ESC1-1]
GeneIDi64124
KEGGirno:64124

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiAGRL4_RAT
AccessioniPrimary (citable) accession number: Q9ESC1
Secondary accession number(s): Q9ESC0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 16, 2004
Last sequence update: March 1, 2001
Last modified: March 28, 2018
This is version 135 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health