Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Adhesion G protein-coupled receptor L4

Gene

Adgrl4

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Endothelial orphan receptor that acts as a key regulator of angiogenesis.By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Keywords - Ligandi

Calcium

Protein family/group databases

MEROPSiP02.013.

Names & Taxonomyi

Protein namesi
Recommended name:
Adhesion G protein-coupled receptor L4
Alternative name(s):
EGF,latrophilin and seven transmembrane domain-containing protein 1
EGF-TM7-latrophilin-related protein
Short name:
ETL protein
Gene namesi
Name:Adgrl4
Synonyms:Eltd1, Etl
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 2

Organism-specific databases

RGDi621136. Adgrl4.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini20 – 480461ExtracellularCuratedAdd
BLAST
Transmembranei481 – 50121Helical; Name=1Sequence analysisAdd
BLAST
Topological domaini502 – 52221CytoplasmicCuratedAdd
BLAST
Transmembranei523 – 54321Helical; Name=2Sequence analysisAdd
BLAST
Topological domaini544 – 5474ExtracellularCurated
Transmembranei548 – 56821Helical; Name=3Sequence analysisAdd
BLAST
Topological domaini569 – 58012CytoplasmicCuratedAdd
BLAST
Transmembranei581 – 60121Helical; Name=4Sequence analysisAdd
BLAST
Topological domaini602 – 62120ExtracellularCuratedAdd
BLAST
Transmembranei622 – 64221Helical; Name=5Sequence analysisAdd
BLAST
Topological domaini643 – 66624CytoplasmicCuratedAdd
BLAST
Transmembranei667 – 68721Helical; Name=6Sequence analysisAdd
BLAST
Topological domaini688 – 6947ExtracellularCurated
Transmembranei695 – 71521Helical; Name=7Sequence analysisAdd
BLAST
Topological domaini716 – 73823CytoplasmicCuratedAdd
BLAST

GO - Cellular componenti

  • cytoplasmic vesicle Source: UniProtKB
  • integral component of membrane Source: UniProtKB-KW
  • plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi455 – 4551T → A: Abolishes cleavage. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1919Sequence analysisAdd
BLAST
Chaini20 – 738719Adhesion G protein-coupled receptor L4PRO_0000012872Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi22 ↔ 32PROSITE-ProRule annotation
Disulfide bondi26 ↔ 41PROSITE-ProRule annotation
Disulfide bondi43 ↔ 55PROSITE-ProRule annotation
Disulfide bondi61 ↔ 73PROSITE-ProRule annotation
Glycosylationi62 – 621N-linked (GlcNAc...)Sequence analysis
Disulfide bondi67 ↔ 82PROSITE-ProRule annotation
Disulfide bondi84 ↔ 105PROSITE-ProRule annotation
Disulfide bondi111 ↔ 123PROSITE-ProRule annotation
Glycosylationi112 – 1121N-linked (GlcNAc...)Sequence analysis
Disulfide bondi117 ↔ 132PROSITE-ProRule annotation
Disulfide bondi134 ↔ 155PROSITE-ProRule annotation
Glycosylationi175 – 1751N-linked (GlcNAc...)Sequence analysis
Glycosylationi226 – 2261N-linked (GlcNAc...)Sequence analysis
Glycosylationi297 – 2971N-linked (GlcNAc...)Sequence analysis
Glycosylationi421 – 4211N-linked (GlcNAc...)Sequence analysis
Glycosylationi429 – 4291N-linked (GlcNAc...)Sequence analysis
Glycosylationi443 – 4431N-linked (GlcNAc...)Sequence analysis

Post-translational modificationi

Proteolytically cleaved into 2 subunits, an extracellular alpha subunit and a seven-transmembrane subunit.1 Publication
Glycosylated.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei454 – 4552Cleavage1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9ESC1.
PRIDEiQ9ESC1.

PTM databases

PhosphoSiteiQ9ESC1.

Expressioni

Tissue specificityi

Abundantly expressed in heart, lung, and kidney. Less evident expression is observed in brain, skeletal muscle, liver and spleen. No expression is detected in testis.1 Publication

Developmental stagei

Up-regulated in the adult heart.1 Publication

Gene expression databases

GenevisibleiQ9ESC1. RN.

Interactioni

Subunit structurei

Heterodimer of 2 chains generated by proteolytic processing; the large extracellular N-terminal fragment and the membrane-bound C-terminal fragment predominantly remain associated and non-covalently linked.1 Publication

GO - Molecular functioni

  • protein dimerization activity Source: RGD

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000045890.

Structurei

3D structure databases

ProteinModelPortaliQ9ESC1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini20 – 5637EGF-like 1PROSITE-ProRule annotationAdd
BLAST
Domaini57 – 10650EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini107 – 15650EGF-like 3; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini414 – 46653GPSPROSITE-ProRule annotationAdd
BLAST

Domaini

The transmembrane domain is not required for cleavage, but it is required for dimer formation.1 Publication

Sequence similaritiesi

Contains 3 EGF-like domains.PROSITE-ProRule annotation
Contains 1 GPS domain.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4193. Eukaryota.
ENOG410XSD2. LUCA.
GeneTreeiENSGT00830000128227.
HOGENOMiHOG000112361.
HOVERGENiHBG101117.
InParanoidiQ9ESC1.
KOiK04595.
OMAiHLTKLMH.
OrthoDBiEOG76DTRK.
PhylomeDBiQ9ESC1.
TreeFamiTF316380.

Family and domain databases

InterProiIPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000742. EGF-like_dom.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR032471. GAIN_dom_N.
IPR017981. GPCR_2-like.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
[Graphical view]
PfamiPF00002. 7tm_2. 1 hit.
PF07645. EGF_CA. 2 hits.
PF16489. GAIN. 1 hit.
PF01825. GPS. 1 hit.
[Graphical view]
PRINTSiPR00249. GPCRSECRETIN.
SMARTiSM00181. EGF. 3 hits.
SM00179. EGF_CA. 2 hits.
SM00303. GPS. 1 hit.
[Graphical view]
PROSITEiPS00010. ASX_HYDROXYL. 2 hits.
PS01186. EGF_2. 1 hit.
PS50026. EGF_3. 3 hits.
PS01187. EGF_CA. 2 hits.
PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9ESC1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRLLLLLVGL STLLNHSYTQ NCKTPCLPNA KCEVLDEVAA CFCSTGYTGN
60 70 80 90 100
GITICEDVDE CNETSVCGDH AVCENTNGGF SCFCVEGYQT STGKTQFTPN
110 120 130 140 150
DGSYCQDVDE CNETSVCGDH AVCENTNGGF SCFCVEGYQT STGKTQFTPN
160 170 180 190 200
DGSYCQEIVN SNCHLEHDCI AANINKTLKR IGPITEQLTL LHEIYKNSEA
210 220 230 240 250
ELSLVDIVTY IEILTESSSL QGYIKNTTSP KDAYFGSALT EFGKTVNNFV
260 270 280 290 300
EKNTHEMWDQ LPTNRRRLHL TKLMHAAEHV TLQISQNIQK NTQFDMNSTD
310 320 330 340 350
LALKVFVFDS VHMKHTHPHM NVDGGYVKIS PRRKSAYDPN GNVIVAFLCY
360 370 380 390 400
RSIGPLLSSS DDFLLGAQSD NSKGKEKVIS SVISASISSN PPTLYELEKI
410 420 430 440 450
TFTLSHVKLS DKHQTQCAFW NYSVDDMNNG SWSSEGCELT YSNDTHTSCR
460 470 480 490 500
CSHLTHFAIL MSPSTSIEVK DYNILTRITQ LGIIISLICL AICIFTFWFF
510 520 530 540 550
SEIQSTRTTI HKNLCCSLFL AQLVFLVGIN INTNKLVCSI IAGLLHYFFL
560 570 580 590 600
AAFAWMCIEG IYLYLIVVGL IYNKGFLHKN FYIFGYLSPA VVVGFSASLG
610 620 630 640 650
YRYYGTTKVC WLSTENNFIW SFIGPACLII LVNLLAFGVI IYKVFRHTAG
660 670 680 690 700
LKPEVSCYEN IRSCARGALA LLFLLGTTWT FGVLHVVHAS VVTAYLFTVS
710 720 730
NAFQGMFIFL FLCVLSRKIQ EEYYRLFKNV PCCFECLR
Length:738
Mass (Da):82,451
Last modified:March 1, 2001 - v1
Checksum:i680D3731FE60EF95
GO
Isoform 2 (identifier: Q9ESC1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     632-662: VNLLAFGVIIYKVFRHTAGLKPEVSCYENIR → IYILVSFTSHIPLNMCAECRRMVSASLHVRL
     663-738: Missing.

Show »
Length:662
Mass (Da):73,803
Checksum:i0FED646DD20F6F30
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei632 – 66231VNLLA…YENIR → IYILVSFTSHIPLNMCAECR RMVSASLHVRL in isoform 2. 1 PublicationVSP_009415Add
BLAST
Alternative sequencei663 – 73876Missing in isoform 2. 1 PublicationVSP_009416Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF192401 mRNA. Translation: AAG33019.1.
AF192402 mRNA. Translation: AAG33020.1.
RefSeqiNP_071630.1. NM_022294.1. [Q9ESC1-1]
UniGeneiRn.8731.

Genome annotation databases

EnsembliENSRNOT00000047564; ENSRNOP00000045890; ENSRNOG00000033940. [Q9ESC1-2]
ENSRNOT00000088437; ENSRNOP00000071560; ENSRNOG00000033940. [Q9ESC1-1]
GeneIDi64124.
KEGGirno:64124.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF192401 mRNA. Translation: AAG33019.1.
AF192402 mRNA. Translation: AAG33020.1.
RefSeqiNP_071630.1. NM_022294.1. [Q9ESC1-1]
UniGeneiRn.8731.

3D structure databases

ProteinModelPortaliQ9ESC1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000045890.

Protein family/group databases

MEROPSiP02.013.
GPCRDBiSearch...

PTM databases

PhosphoSiteiQ9ESC1.

Proteomic databases

PaxDbiQ9ESC1.
PRIDEiQ9ESC1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000047564; ENSRNOP00000045890; ENSRNOG00000033940. [Q9ESC1-2]
ENSRNOT00000088437; ENSRNOP00000071560; ENSRNOG00000033940. [Q9ESC1-1]
GeneIDi64124.
KEGGirno:64124.

Organism-specific databases

CTDi64123.
RGDi621136. Adgrl4.

Phylogenomic databases

eggNOGiKOG4193. Eukaryota.
ENOG410XSD2. LUCA.
GeneTreeiENSGT00830000128227.
HOGENOMiHOG000112361.
HOVERGENiHBG101117.
InParanoidiQ9ESC1.
KOiK04595.
OMAiHLTKLMH.
OrthoDBiEOG76DTRK.
PhylomeDBiQ9ESC1.
TreeFamiTF316380.

Miscellaneous databases

NextBioi612763.
PROiQ9ESC1.

Gene expression databases

GenevisibleiQ9ESC1. RN.

Family and domain databases

InterProiIPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000742. EGF-like_dom.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR032471. GAIN_dom_N.
IPR017981. GPCR_2-like.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
[Graphical view]
PfamiPF00002. 7tm_2. 1 hit.
PF07645. EGF_CA. 2 hits.
PF16489. GAIN. 1 hit.
PF01825. GPS. 1 hit.
[Graphical view]
PRINTSiPR00249. GPCRSECRETIN.
SMARTiSM00181. EGF. 3 hits.
SM00179. EGF_CA. 2 hits.
SM00303. GPS. 1 hit.
[Graphical view]
PROSITEiPS00010. ASX_HYDROXYL. 2 hits.
PS01186. EGF_2. 1 hit.
PS50026. EGF_3. 3 hits.
PS01187. EGF_CA. 2 hits.
PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "ETL, a novel seven-transmembrane receptor that is developmentally regulated in the heart."
    Nechiporuk T., Urness L.D., Keating M.T.
    J. Biol. Chem. 276:4150-4157(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), MUTAGENESIS OF THR-455, SUBUNIT, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE, PROTEOLYTIC PROCESSING.

Entry informationi

Entry nameiAGRL4_RAT
AccessioniPrimary (citable) accession number: Q9ESC1
Secondary accession number(s): Q9ESC0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 16, 2004
Last sequence update: March 1, 2001
Last modified: May 11, 2016
This is version 124 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.