Q9ES28 (ARHG7_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 118.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Rho guanine nucleotide exchange factor 7 Alternative name(s): Beta-Pix PAK-interacting exchange factor beta p85SPR | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 862 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts as a RAC1 guanine nucleotide exchange factor (GEF) and can induce membrane ruffling. May function as a positive regulator of apoptosis. Functions in cell migration, attachment and cell spreading. Promotes targeting of RAC1 to focal adhesions. Downstream of NMDA receptors and CaMKK-CaMK1 signaling cascade, promotes the formation of spines and synapses in hippocampal neurons By similarity. Ref.11 |
| Subunit structure | Interacts with PAK kinases through the SH3 domain. Interacts with unphosphorylated PAK1. Interacts with ITCH. Interacts with SCRIB; interaction is direct and may play a role in regulation of apoptosis By similarity. Interacts with GIT1 and TGFB1I1. Interacts with FRMPD4 (via N-terminus). Interacts with CaMK1. Interacts with BIN2 By similarity. Interacts with PTK2/FAK1 and RAC1. Interacts with PARVB. Ref.8 Ref.9 Ref.11 Ref.14 |
| Subcellular location | Cell junction › focal adhesion. Cell projection › ruffle. Cytoplasm › cell cortex. Cell projection › lamellipodium. Note: Detected at cell adhesions. A small proportion is detected at focal adhesions. Ref.11 Ref.14 |
| Tissue specificity | Seems to be expressed in the central nervous system. Isoform B, isoform C and isoform E are expressed with highest levels in brain and testis. Ref.5 Ref.6 |
| Post-translational modification | Phosphorylated on Ser-673 by CaMK1; enhancement of GEF activity and downstream activation of RAC1 By similarity. Phosphorylated by PTK2/FAK1; this promotes interaction with RAC1. Ref.11 |
| Sequence similarities | Contains 1 CH (calponin-homology) domain. Contains 1 DH (DBL-homology) domain. Contains 1 PH domain. Contains 1 SH3 domain. |
| Sequence caution | The sequence AAB57691.1 differs from that shown. Reason: Erroneous initiation. The sequence AAG18017.1 differs from that shown. Reason: Erroneous initiation. The sequence AAG18018.1 differs from that shown. Reason: Erroneous initiation. The sequence AAH44838.1 differs from that shown. Reason: Erroneous initiation. The sequence AAK97363.1 differs from that shown. Reason: Erroneous initiation. The sequence BAC35033.1 differs from that shown. Reason: Erroneous initiation. The sequence BAC97874.1 differs from that shown. Reason: Erroneous initiation. The sequence BAE23905.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Git1 | Q68FF6 | 2 | EBI-642580,EBI-645933 | |
| Git1 | Q9Z272 | 2 | EBI-642580,EBI-3842379 | From a different organism. |
| GIT2 | Q14161 | 2 | EBI-642580,EBI-1046878 | From a different organism. |
| Git2 | Q9JLQ2 | 6 | EBI-642580,EBI-642860 |
Alternative products
| This entry describes 8 isoforms produced by alternative splicing and alternative initiation. [Align] [Select] | ||||||
| Isoform B (identifier: Q9ES28-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform A (identifier: Q9ES28-2) The sequence of this isoform differs from the canonical sequence as follows: 712-771: TWQGTDLMHNHVLADDDQSSLDSLGRRSSLSRLEPSDLSEDSEYDSIWTAHSYRMGSASR → S | ||||||
| Isoform C (identifier: Q9ES28-3) The sequence of this isoform differs from the canonical sequence as follows: 576-650: Missing. | ||||||
| Isoform D (identifier: Q9ES28-4) The sequence of this isoform differs from the canonical sequence as follows: 1-52: Missing. 53-55: IEK → MLQ 712-771: TWQGTDLMHNHVLADDDQSSLDSLGRRSSLSRLEPSDLSEDSEYDSIWTAHSYRMGSASR → S | ||||||
| Isoform E (identifier: Q9ES28-5) Also known as: d; The sequence of this isoform differs from the canonical sequence as follows: 772-824: SRKESAPQVLLPEEEKIIVEETKSNGQTVIEEKSLVDTVYALKDEVQELRQDN → KSCCSYISHQN 825-862: Missing. | ||||||
| Isoform F (identifier: Q9ES28-6) The sequence of this isoform differs from the canonical sequence as follows: 1-52: Missing. 53-55: IEK → MLQ 712-820: TWQGTDLMHN...YALKDEVQEL → SECRSSPRVGTDYKQLLHGLAALEREVSGA 821-862: Missing. | ||||||
| Isoform G (identifier: Q9ES28-7) Also known as: b(L); The sequence of this isoform differs from the canonical sequence as follows: 1-52: Missing. 53-55: IEK → MLQ | ||||||
| Isoform H (identifier: Q9ES28-8) Also known as: b; The sequence of this isoform differs from the canonical sequence as follows: 1-157: Missing. | ||||||
| Note: Produced by alternative initiation at Met-158 of isoform G. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||
Molecule processing | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 862 | 862 | Rho guanine nucleotide exchange factor 7 | PRO_0000080922 | |||||||||||||||
Regions | |||||||||||||||||||
| Domain | 1 – 111 | 111 | CH | ||||||||||||||||
| Domain | 163 – 222 | 60 | SH3 | ||||||||||||||||
| Domain | 250 – 430 | 181 | DH | ||||||||||||||||
| Domain | 452 – 557 | 106 | PH | ||||||||||||||||
| Coiled coil | 804 – 854 | 51 | Potential | ||||||||||||||||
Amino acid modifications | |||||||||||||||||||
| Modified residue | 132 | 1 | Phosphoserine Ref.15 | ||||||||||||||||
| Modified residue | 155 | 1 | Phosphoserine Ref.13 | ||||||||||||||||
| Modified residue | 164 | 1 | Phosphoserine Ref.17 | ||||||||||||||||
| Modified residue | 228 | 1 | Phosphoserine By similarity | ||||||||||||||||
| Modified residue | 497 | 1 | Phosphoserine Ref.12 Ref.16 | ||||||||||||||||
| Modified residue | 673 | 1 | Phosphoserine; by CaMK1 By similarity | ||||||||||||||||
| Modified residue | 776 | 1 | Phosphoserine Ref.15 | ||||||||||||||||
Natural variations | |||||||||||||||||||
| Alternative sequence | 1 – 157 | 157 | Missing in isoform H. | VSP_023051 | |||||||||||||||
| Alternative sequence | 1 – 52 | 52 | Missing in isoform D, isoform F and isoform G. | VSP_023052 | |||||||||||||||
| Alternative sequence | 53 – 55 | 3 | IEK → MLQ in isoform D, isoform F and isoform G. | VSP_023053 | |||||||||||||||
| Alternative sequence | 576 – 650 | 75 | Missing in isoform C. | VSP_001816 | |||||||||||||||
| Alternative sequence | 712 – 820 | 109 | TWQGT…EVQEL → SECRSSPRVGTDYKQLLHGL AALEREVSGA in isoform F. | VSP_023054 | |||||||||||||||
| Alternative sequence | 712 – 771 | 60 | TWQGT…GSASR → S in isoform A and isoform D. | VSP_001817 | |||||||||||||||
| Alternative sequence | 772 – 824 | 53 | SRKES…LRQDN → KSCCSYISHQN in isoform E. | VSP_023055 | |||||||||||||||
| Alternative sequence | 821 – 862 | 42 | Missing in isoform F. | VSP_023056 | |||||||||||||||
| Alternative sequence | 825 – 862 | 38 | Missing in isoform E. | VSP_023057 | |||||||||||||||
Experimental info | |||||||||||||||||||
| Sequence conflict | 485 – 488 | 4 | NLLL → KPSV in AAO65479. Ref.2 | ||||||||||||||||
| Sequence conflict | 485 – 488 | 4 | NLLL → KPSV in AAG18017. Ref.5 | ||||||||||||||||
| Sequence conflict | 485 – 488 | 4 | NLLL → KPSV in AAG18018. Ref.5 | ||||||||||||||||
| Sequence conflict | 485 – 488 | 4 | NLLL → KPSV in AAB57691. Ref.7 | ||||||||||||||||
| Sequence conflict | 492 | 1 | A → P in AAO65479. Ref.2 | ||||||||||||||||
| Sequence conflict | 492 | 1 | A → P in AAG18017. Ref.5 | ||||||||||||||||
| Sequence conflict | 492 | 1 | A → P in AAG18018. Ref.5 | ||||||||||||||||
| Sequence conflict | 492 | 1 | A → P in AAB57691. Ref.7 | ||||||||||||||||
| Sequence conflict | 616 | 1 | S → R in AAO65479. Ref.2 | ||||||||||||||||
| Sequence conflict | 616 | 1 | S → R in AAG18017. Ref.5 | ||||||||||||||||
| Sequence conflict | 616 | 1 | S → R in AAB57691. Ref.7 | ||||||||||||||||
| Sequence conflict | 624 – 625 | 2 | KT → PH in AAB57691. Ref.7 | ||||||||||||||||
| Sequence conflict | 628 | 1 | P → A in AAO65479. Ref.2 | ||||||||||||||||
| Sequence conflict | 628 | 1 | P → A in AAB57691. Ref.7 | ||||||||||||||||
| Sequence conflict | 630 | 1 | S → G in AAB57691. Ref.7 | ||||||||||||||||
| Sequence conflict | 633 | 1 | C → W in AAO65479. Ref.2 | ||||||||||||||||
| Sequence conflict | 633 | 1 | C → W in AAG18017. Ref.5 | ||||||||||||||||
| Sequence conflict | 633 | 1 | C → W in AAB57691. Ref.7 | ||||||||||||||||
| Sequence conflict | 635 – 636 | 2 | RP → WT in AAB57691. Ref.7 | ||||||||||||||||
Secondary structure | |||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||
| Beta strand | 167 – 172 | 6 | |||||||||||||||||
| Beta strand | 189 – 195 | 7 | |||||||||||||||||
| Beta strand | 199 – 205 | 7 | |||||||||||||||||
| Beta strand | 208 – 213 | 6 | |||||||||||||||||
| Helix | 214 – 216 | 3 | |||||||||||||||||
| Beta strand | 217 – 219 | 3 | |||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H. DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM E). Tissue: Brain. |
| [2] | "betaPix-b(L), a novel isoform of betaPix, is generated by alternative translation." Rhee S., Yang S.J., Lee S.J., Park D. Biochem. Biophys. Res. Commun. 318:415-421(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS G AND H). Strain: ICR. Tissue: Brain. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS D AND F). Strain: C57BL/6J. Tissue: Cerebellum and Lung. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM D). Strain: FVB/N. Tissue: Mammary tumor. |
| [5] | "Molecular cloning of neuronally expressed mouse betaPix isoforms." Kim S., Kim T., Lee D., Park S.-H., Kim H., Park D. Biochem. Biophys. Res. Commun. 272:721-725(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 59-862 (ISOFORM B), NUCLEOTIDE SEQUENCE [MRNA] OF 150-862 (ISOFORM C), TISSUE SPECIFICITY. Strain: C57BL/6. Tissue: Brain. |
| [6] | "Molecular cloning and characterization of a novel mouse betaPix isoform." Kim T., Park D. Mol. Cells 11:89-94(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 63-862 (ISOFORM E), TISSUE SPECIFICITY. Strain: C57BL/6. Tissue: Brain. |
| [7] | "Cloning of a SH3 domain-containing proline-rich protein, p85SPR, and its localization in focal adhesion." Oh W.K., Yoo J.C., Jo D., Song Y.H., Kim M.G., Park D. Biochem. Biophys. Res. Commun. 235:794-798(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 126-862 (ISOFORM A). Tissue: Thymus. |
| [8] | "A tyrosine-phosphorylated protein that binds to an important regulatory region on the cool family of p21-activated kinase-binding proteins." Bagrodia S., Bailey D., Lenard Z., Hart M., Guan J.L., Premont R.T., Taylor S.J., Cerione R.A. J. Biol. Chem. 274:22393-22400(1999) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH GIT1. |
| [9] | "Hic-5 interacts with GIT1 with a different binding mode from paxillin." Nishiya N., Shirai T., Suzuki W., Nose K. J. Biochem. 132:279-289(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH GIT1 AND TGFB1I1. |
| [10] | "Proteomic analysis of in vivo phosphorylated synaptic proteins." Collins M.O., Yu L., Coba M.P., Husi H., Campuzano I., Blackstock W.P., Choudhary J.S., Grant S.G. J. Biol. Chem. 280:5972-5982(2005) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-673, MASS SPECTROMETRY. Tissue: Forebrain. |
| [11] | "FAK potentiates Rac1 activation and localization to matrix adhesion sites: a role for betaPIX." Chang F., Lemmon C.A., Park D., Romer L.H. Mol. Biol. Cell 18:253-264(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, PHOSPHORYLATION, SUBCELLULAR LOCATION, INTERACTION WITH PTK2/FAK1. |
| [12] | "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations." Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M. Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-497, MASS SPECTROMETRY. Tissue: Brain cortex. |
| [13] | "Large-scale phosphorylation analysis of mouse liver." Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-155, MASS SPECTROMETRY. Tissue: Liver. |
| [14] | "Affixin activates Rac1 via betaPIX in C2C12 myoblast." Matsuda C., Kameyama K., Suzuki A., Mishima W., Yamaji S., Okamoto H., Nishino I., Hayashi Y.K. FEBS Lett. 582:1189-1196(2008) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, INTERACTION WITH PARVB. |
| [15] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-132; SER-673 AND SER-776, MASS SPECTROMETRY. Tissue: Melanoma. |
| [16] | "The phagosomal proteome in interferon-gamma-activated macrophages." Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P. Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-497 AND SER-673, MASS SPECTROMETRY. Tissue: Macrophage. |
| [17] | "Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry." Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J. Mol. Cell. Proteomics 8:904-912(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-164, MASS SPECTROMETRY. Tissue: Embryonic fibroblast. |
| [18] | "Crystal structure of the N-terminal SH3 domain of mouse betaPIX, p21-activated kinase-interacting exchange factor." Li X., Liu X., Sun F., Gao J., Zhou H., Gao G.F., Bartlam M., Rao Z. Biochem. Biophys. Res. Commun. 339:407-414(2006) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.01 ANGSTROMS) OF 164-220. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AK129064 mRNA. Translation: BAC97874.1. Different initiation. AY220301 mRNA. Translation: AAO65479.1. AK052545 mRNA. Translation: BAC35033.1. Different initiation. AK139156 mRNA. Translation: BAE23905.1. Different initiation. BC044838 mRNA. Translation: AAH44838.1. Different initiation. AF247654 mRNA. Translation: AAG18017.1. Different initiation. AF247655 mRNA. Translation: AAG18018.1. Different initiation. AF343877 mRNA. Translation: AAK97363.1. Different initiation. U96634 mRNA. Translation: AAB57691.1. Different initiation. | ||||||||||||
| IPI | IPI00230704. IPI00331212. IPI00387322. IPI00655136. IPI00828241. IPI00828536. IPI00828723. IPI00828966. | ||||||||||||
| RefSeq | NP_001106989.1. NM_001113517.1. NP_001106990.1. NM_001113518.1. NP_059098.2. NM_017402.4. | ||||||||||||
| UniGene | Mm.244068. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9ES28. | ||||||||||||
| SMR | Q9ES28. Positions 1-116, 130-557, 803-862. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9ES28. 11 interactions. | ||||||||||||
| MINT | MINT-1786275. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9ES28. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9ES28. | ||||||||||||
| PRIDE | Q9ES28. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSMUST00000033908; ENSMUSP00000033908; ENSMUSG00000031511. ENSMUST00000074856; ENSMUSP00000074399; ENSMUSG00000031511. ENSMUST00000098938; ENSMUSP00000096538; ENSMUSG00000031511. ENSMUST00000110909; ENSMUSP00000106534; ENSMUSG00000031511. | ||||||||||||
| GeneID | 54126. | ||||||||||||
| KEGG | mmu:54126. | ||||||||||||
| UCSC | uc009kvu.2. mouse. uc009kvv.2. mouse. uc009kvw.2. mouse. uc009kvx.2. mouse. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 8874. | ||||||||||||
| MGI | MGI:1860493. Arhgef7. | ||||||||||||
| Rouge | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG314429. | ||||||||||||
| GeneTree | ENSGT00690000101859. | ||||||||||||
| HOVERGEN | HBG050569. | ||||||||||||
| InParanoid | Q9ES28. | ||||||||||||
| KO | K13710. | ||||||||||||
| OMA | QCAGNEE. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9ES28. | ||||||||||||
| Bgee | Q9ES28. | ||||||||||||
| CleanEx | MM_ARHGEF7. | ||||||||||||
| Genevestigator | Q9ES28. | ||||||||||||
| GermOnline | ENSMUSG00000031511. Mus musculus. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.10.418.10. 1 hit. 1.20.900.10. 1 hit. 2.30.29.30. 1 hit. | ||||||||||||
| InterPro | IPR001715. CH-domain. IPR000219. DH-domain. IPR001331. GDS_CDC24_CS. IPR011993. PH_like_dom. IPR001849. Pleckstrin_homology. IPR011511. SH3_2. IPR001452. SH3_domain. [Graphical view] | ||||||||||||
| Pfam | PF00307. CH. 1 hit. PF00169. PH. 1 hit. PF00621. RhoGEF. 1 hit. PF07653. SH3_2. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00452. SH3DOMAIN. | ||||||||||||
| SMART | SM00033. CH. 1 hit. SM00233. PH. 1 hit. SM00325. RhoGEF. 1 hit. SM00326. SH3. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF47576. Calponin-homology. 1 hit. SSF48065. DH-domain. 1 hit. SSF50044. SH3. 1 hit. | ||||||||||||
| PROSITE | PS50021. CH. 1 hit. PS00741. DH_1. 1 hit. PS50010. DH_2. 1 hit. PS50003. PH_DOMAIN. 1 hit. PS50002. SH3. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | Q9ES28. | ||||||||||||
| NextBio | 310921. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | ARHG7_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9ES28 Secondary accession number(s): O08757 Q9ES27 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
